BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_O10 (579 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1341 - 36434098-36436080 32 0.29 11_04_0320 + 16354122-16354226,16354652-16356859 29 2.7 04_04_0721 - 27549212-27549646,27549739-27549962,27550074-275502... 28 4.7 03_02_0422 - 8308711-8309100,8309197-8310724,8311394-8313411 27 8.2 >01_06_1341 - 36434098-36436080 Length = 660 Score = 32.3 bits (70), Expect = 0.29 Identities = 30/80 (37%), Positives = 39/80 (48%), Gaps = 3/80 (3%) Frame = +1 Query: 121 DSSALLKYD---ELYYNIVIGRYVSAARITMELKNEGRGEVIRLVVNKLLAESKRNVVDY 291 D+ A+L YD E I++G A + L N GRGEVIR+ N L E +V + Sbjct: 572 DTGAVL-YDIEEEEKEKILLGHSEKLA-VAFGLINTGRGEVIRITKNLRLCEDCHSVTKF 629 Query: 292 AYKLVRKGEIGIVRDYFPIH 351 K + EI IVRD H Sbjct: 630 ISKYAER-EI-IVRDVNRFH 647 >11_04_0320 + 16354122-16354226,16354652-16356859 Length = 770 Score = 29.1 bits (62), Expect = 2.7 Identities = 21/72 (29%), Positives = 37/72 (51%) Frame = +1 Query: 187 AARITMELKNEGRGEVIRLVVNKLLAESKRNVVDYAYKLVRKGEIGIVRDYFPIHFRWIL 366 AA +ELK +G E L++N ++ + V KL+++ ++GI+RD WI Sbjct: 584 AADKLLELKPKGI-ETYILLLNMYISTERWQDVARVRKLMKQEDVGILRDR-----SWIT 637 Query: 367 LGEQVKFINLRD 402 + ++V F D Sbjct: 638 IKDKVYFFRAND 649 >04_04_0721 - 27549212-27549646,27549739-27549962,27550074-27550227, 27568477-27568821,27568899-27569152,27569257-27569383 Length = 512 Score = 28.3 bits (60), Expect = 4.7 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -1 Query: 519 PPMRDYFPRHSITLPFVFVTVRTSIAISVCTPFE 418 P +R YF T FVF+ V ++I+ + TP E Sbjct: 267 PALRAYFAEFFSTFLFVFIAVGSTISARMLTPDE 300 >03_02_0422 - 8308711-8309100,8309197-8310724,8311394-8313411 Length = 1311 Score = 27.5 bits (58), Expect = 8.2 Identities = 21/56 (37%), Positives = 30/56 (53%) Frame = +1 Query: 181 VSAARITMELKNEGRGEVIRLVVNKLLAESKRNVVDYAYKLVRKGEIGIVRDYFPI 348 V+ RI+ E + +G E + VV+ L RNVV RKGE+ +V DY P+ Sbjct: 379 VAVKRISHESR-QGMKEFVAEVVS-LGRLRHRNVVQLLDYCRRKGELLLVYDYMPM 432 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,048,784 Number of Sequences: 37544 Number of extensions: 264510 Number of successful extensions: 654 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1352600424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -