BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_O09 (564 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-... 23 5.2 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 23 9.1 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 23 9.1 >AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-A-gated chloride channelprotein. Length = 459 Score = 23.4 bits (48), Expect = 5.2 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = -2 Query: 257 EQIVIGSKICHNDKIKYYEFISNRDYLIRLISDFSNSY 144 E+I + NDK + ++ R+ L+RL D + +Y Sbjct: 95 EKIWVPDTFFANDKNSFLHDVTERNKLVRLAGDGAVTY 132 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 22.6 bits (46), Expect = 9.1 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 48 PY*KDFFM*NIYLNRFLAWRRMPW 119 P+ K FF+ +L RFL +R P+ Sbjct: 342 PWVKTFFIGKDFLPRFLFMKRPPY 365 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 22.6 bits (46), Expect = 9.1 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 48 PY*KDFFM*NIYLNRFLAWRRMPW 119 P+ K FF+ +L RFL +R P+ Sbjct: 342 PWVKTFFIGKDFLPRFLFMKRPPY 365 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 504,590 Number of Sequences: 2352 Number of extensions: 9971 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52983882 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -