BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_O09 (564 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z33622-1|CAA83916.1| 737|Homo sapiens muscle glycogen synthase ... 30 6.5 U32573-1|AAB60385.1| 736|Homo sapiens UDP glucose:glycogen 4-al... 30 6.5 J04501-1|AAA88046.1| 737|Homo sapiens glycogen synthase protein. 30 6.5 BC007688-1|AAH07688.1| 737|Homo sapiens glycogen synthase 1 (mu... 30 6.5 BC003182-1|AAH03182.1| 673|Homo sapiens GYS1 protein protein. 30 6.5 BC002617-1|AAH02617.1| 737|Homo sapiens glycogen synthase 1 (mu... 30 6.5 AK223579-1|BAD97299.1| 737|Homo sapiens glycogen synthase 1 (mu... 30 6.5 >Z33622-1|CAA83916.1| 737|Homo sapiens muscle glycogen synthase protein. Length = 737 Score = 29.9 bits (64), Expect = 6.5 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = -2 Query: 563 MMYIILNFYKFTNKNDKIYLE-LVFLSYLSRLNNSTKYV 450 + + I Y+F+NK ++LE L L+YL R+N S + V Sbjct: 324 LYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTV 362 >U32573-1|AAB60385.1| 736|Homo sapiens UDP glucose:glycogen 4-alpha-D- glycosytransferase protein. Length = 736 Score = 29.9 bits (64), Expect = 6.5 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = -2 Query: 563 MMYIILNFYKFTNKNDKIYLE-LVFLSYLSRLNNSTKYV 450 + + I Y+F+NK ++LE L L+YL R+N S + V Sbjct: 324 LYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTV 362 >J04501-1|AAA88046.1| 737|Homo sapiens glycogen synthase protein. Length = 737 Score = 29.9 bits (64), Expect = 6.5 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = -2 Query: 563 MMYIILNFYKFTNKNDKIYLE-LVFLSYLSRLNNSTKYV 450 + + I Y+F+NK ++LE L L+YL R+N S + V Sbjct: 324 LYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTV 362 >BC007688-1|AAH07688.1| 737|Homo sapiens glycogen synthase 1 (muscle) protein. Length = 737 Score = 29.9 bits (64), Expect = 6.5 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = -2 Query: 563 MMYIILNFYKFTNKNDKIYLE-LVFLSYLSRLNNSTKYV 450 + + I Y+F+NK ++LE L L+YL R+N S + V Sbjct: 324 LYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTV 362 >BC003182-1|AAH03182.1| 673|Homo sapiens GYS1 protein protein. Length = 673 Score = 29.9 bits (64), Expect = 6.5 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = -2 Query: 563 MMYIILNFYKFTNKNDKIYLE-LVFLSYLSRLNNSTKYV 450 + + I Y+F+NK ++LE L L+YL R+N S + V Sbjct: 260 LYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTV 298 >BC002617-1|AAH02617.1| 737|Homo sapiens glycogen synthase 1 (muscle) protein. Length = 737 Score = 29.9 bits (64), Expect = 6.5 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = -2 Query: 563 MMYIILNFYKFTNKNDKIYLE-LVFLSYLSRLNNSTKYV 450 + + I Y+F+NK ++LE L L+YL R+N S + V Sbjct: 324 LYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTV 362 >AK223579-1|BAD97299.1| 737|Homo sapiens glycogen synthase 1 (muscle) variant protein. Length = 737 Score = 29.9 bits (64), Expect = 6.5 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = -2 Query: 563 MMYIILNFYKFTNKNDKIYLE-LVFLSYLSRLNNSTKYV 450 + + I Y+F+NK ++LE L L+YL R+N S + V Sbjct: 324 LYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTV 362 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 65,796,180 Number of Sequences: 237096 Number of extensions: 1252914 Number of successful extensions: 1999 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1967 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1999 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5703349406 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -