BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_O06 (437 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) 29 1.7 SB_33380| Best HMM Match : Herpes_capsid (HMM E-Value=3) 28 3.9 SB_8164| Best HMM Match : rve (HMM E-Value=0.00069) 28 3.9 SB_909| Best HMM Match : Transgly_assoc (HMM E-Value=2.2) 27 8.9 >SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) Length = 2123 Score = 29.1 bits (62), Expect = 1.7 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 68 TLSVPEWTTCSKIKLVHLRPPHTPMSLTATTTLWAE 175 TLS + T+ S ++ PPH+P + T TTT E Sbjct: 1748 TLSTLKTTSTSTSTTKYIPPPHSPPTTTTTTTTTPE 1783 >SB_33380| Best HMM Match : Herpes_capsid (HMM E-Value=3) Length = 474 Score = 27.9 bits (59), Expect = 3.9 Identities = 20/55 (36%), Positives = 24/55 (43%) Frame = +2 Query: 122 RPPHTPMSLTATTTLWAEN*IFSXXXXXXWTSTPVGRSSIHHSLSPRGNPAPVFL 286 RPP P S T+ TT A S T++PV SS + S PAP L Sbjct: 129 RPPPRPAS-TSLTTSAAFTSSTSSAASTSLTTSPVSTSSTSSAASTSLTPAPNIL 182 >SB_8164| Best HMM Match : rve (HMM E-Value=0.00069) Length = 1117 Score = 27.9 bits (59), Expect = 3.9 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = -3 Query: 243 CIELLPTGVEVQRRGGRLEKIQFSAQRVVVAV 148 CI L+ T +V+RR +L + FSA+ V ++V Sbjct: 318 CIRLVNTRDDVKRRSEQLVNLAFSARHVGISV 349 >SB_909| Best HMM Match : Transgly_assoc (HMM E-Value=2.2) Length = 243 Score = 26.6 bits (56), Expect = 8.9 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = -3 Query: 246 WCIELLPTGVEVQRRGGRLEKIQFSAQRVVVAVKDIGV 133 WC+ + E QRR GR+ I F+ ++ IG+ Sbjct: 102 WCLRDIDQSREKQRRRGRINNIFFALSFILSGSLIIGI 139 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,376,701 Number of Sequences: 59808 Number of extensions: 252860 Number of successful extensions: 811 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 620 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 811 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 847047381 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -