BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_O06 (437 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding pr... 27 0.39 AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding pr... 27 0.39 AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding pr... 27 0.39 AM182454-1|CAJ65692.1| 182|Anopheles gambiae globin 2 protein. 23 4.8 AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. 23 6.3 AY146755-1|AAO12070.1| 320|Anopheles gambiae odorant-binding pr... 22 8.3 AY146754-1|AAO12069.1| 334|Anopheles gambiae odorant-binding pr... 22 8.3 AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. 22 8.3 >AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding protein AgamOBP30 protein. Length = 289 Score = 26.6 bits (56), Expect = 0.39 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +3 Query: 45 YSSSSELQHCRCRSGLHVQR*NWCICDRRTHRCL*PQRL 161 ++ + +Q RS H N C +RRT+RCL QRL Sbjct: 97 WNDTHGVQEASMRSFFHPDP-NDCDYERRTYRCLHSQRL 134 >AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding protein OBPjj83c protein. Length = 273 Score = 26.6 bits (56), Expect = 0.39 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +3 Query: 45 YSSSSELQHCRCRSGLHVQR*NWCICDRRTHRCL*PQRL 161 ++ + +Q RS H N C +RRT+RCL QRL Sbjct: 81 WNDTHGVQEASMRSFFHPDP-NDCDYERRTYRCLHSQRL 118 >AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding protein 1 protein. Length = 289 Score = 26.6 bits (56), Expect = 0.39 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +3 Query: 45 YSSSSELQHCRCRSGLHVQR*NWCICDRRTHRCL*PQRL 161 ++ + +Q RS H N C +RRT+RCL QRL Sbjct: 97 WNDTHGVQEASMRSFFHPDP-NDCDYERRTYRCLHSQRL 134 >AM182454-1|CAJ65692.1| 182|Anopheles gambiae globin 2 protein. Length = 182 Score = 23.0 bits (47), Expect = 4.8 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 64 FNTVGAGVDYMFKDKIGASAT 126 F VGA ++Y FKD + AT Sbjct: 72 FKAVGALIEYGFKDPVLFDAT 92 >AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. Length = 438 Score = 22.6 bits (46), Expect = 6.3 Identities = 12/50 (24%), Positives = 22/50 (44%) Frame = -2 Query: 403 IKLKVYYYLCTKTYNSIYILKLIFYKSQLKYC*FKSTLKKKNWCWVPTRT 254 + LK + T+ N+ I + K L YC + ++ + W+P T Sbjct: 3 VTLKGCFTNPTECNNTECIDTTTYAKKNLNYCCCRGSMCNREHKWIPEAT 52 >AY146755-1|AAO12070.1| 320|Anopheles gambiae odorant-binding protein AgamOBP32 protein. Length = 320 Score = 22.2 bits (45), Expect = 8.3 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 114 CICDRRTHRCL*PQRL 161 C +RRT+ CL QRL Sbjct: 103 CDYERRTYHCLNSQRL 118 >AY146754-1|AAO12069.1| 334|Anopheles gambiae odorant-binding protein AgamOBP33 protein. Length = 334 Score = 22.2 bits (45), Expect = 8.3 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 114 CICDRRTHRCL*PQRL 161 C +RRT+ CL QRL Sbjct: 103 CDYERRTYHCLNSQRL 118 >AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. Length = 93 Score = 22.2 bits (45), Expect = 8.3 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = -2 Query: 391 VYYYLCTKTYNSIYI 347 +YYY+C T N+ + Sbjct: 77 IYYYMCKSTKNTFTV 91 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 425,502 Number of Sequences: 2352 Number of extensions: 7827 Number of successful extensions: 20 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36568146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -