BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_O02 (116 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z29373-1|CAA82564.1| 1257|Homo sapiens neural cell adhesion mole... 30 1.2 X59847-1|CAA42508.1| 1257|Homo sapiens Neural cell adhesion mole... 30 1.2 M77640-1|AAC14352.1| 1257|Homo sapiens L1 cell adhesion molecule... 30 1.2 M74387-1|AAA59476.1| 1253|Homo sapiens cell adhesion molecule L1... 30 1.2 EF506611-1|ABP88252.1| 1248|Homo sapiens non-neural L1CAM protein. 30 1.2 DQ173642-2|ABC25979.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173641-2|ABC25974.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173640-2|ABC25969.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173639-2|ABC25964.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173638-2|ABC25959.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173637-2|ABC25954.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173636-2|ABC25949.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173635-2|ABC25944.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173634-2|ABC25939.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173633-2|ABC25934.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173632-2|ABC25929.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173631-2|ABC25924.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173630-2|ABC25919.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173629-2|ABC25914.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173628-2|ABC25909.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173627-2|ABC25904.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173626-2|ABC25899.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173625-2|ABC25894.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173624-2|ABC25889.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173623-2|ABC25884.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173622-2|ABC25879.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173621-2|ABC25874.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173620-2|ABC25869.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173619-2|ABC25864.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173618-2|ABC25859.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173617-2|ABC25854.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173616-2|ABC25849.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173615-2|ABC25844.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173614-2|ABC25839.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173613-2|ABC25834.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173612-2|ABC25829.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173611-2|ABC25824.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173610-2|ABC25819.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173609-2|ABC25814.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173608-2|ABC25809.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173607-2|ABC25804.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173606-2|ABC25799.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173605-2|ABC25794.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173604-2|ABC25789.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173603-2|ABC25784.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173602-2|ABC25779.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173601-2|ABC25774.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173600-2|ABC25769.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173599-2|ABC25764.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173598-2|ABC25759.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173597-2|ABC25755.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173596-2|ABC25750.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173595-2|ABC25745.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173594-2|ABC25740.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173593-2|ABC25735.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173592-2|ABC25730.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 DQ173589-1|ABB58724.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 BC126229-1|AAI26230.1| 1257|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167726-1|AAO17629.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167725-1|AAO17628.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167724-1|AAO17627.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167723-1|AAO17626.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167722-1|AAO17625.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167721-1|AAO17624.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167720-1|AAO17623.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167719-1|AAO17622.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167718-1|AAO17621.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167717-1|AAO17620.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167716-1|AAO17619.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167715-1|AAO17618.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167714-1|AAO17617.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167713-1|AAO17616.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167712-1|AAO17615.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167711-1|AAO17614.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167710-1|AAO17613.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167709-1|AAO17612.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167708-1|AAO17611.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167707-1|AAO17610.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167706-1|AAO17609.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167705-1|AAO17608.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167704-1|AAO17607.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167703-1|AAO17606.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167702-1|AAO17605.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167701-1|AAO17604.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167700-1|AAO17603.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167699-1|AAO17602.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167698-1|AAO17601.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167697-1|AAO17600.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167696-1|AAO17599.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167695-1|AAO17598.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167694-1|AAO17597.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167693-1|AAO17596.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167692-1|AAO17595.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167691-1|AAO17594.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167690-1|AAO17593.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167689-1|AAO17592.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167688-1|AAO17591.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167687-1|AAO17590.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167686-1|AAO17589.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167685-1|AAO17588.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167684-1|AAO17587.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167683-1|AAO17586.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167682-1|AAO17585.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167681-1|AAO17584.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AY167680-1|AAO17583.1| 534|Homo sapiens L1 cell adhesion molecu... 30 1.2 AB102653-1|BAC81122.1| 1255|Homo sapiens L1 cell adhesion molecu... 30 1.2 AB101970-1|BAC80529.1| 83|Homo sapiens L1 cell adhesion molecu... 30 1.2 AB101969-1|BAC80528.1| 83|Homo sapiens L1 cell adhesion molecu... 30 1.2 AB101968-1|BAC80527.1| 83|Homo sapiens L1 cell adhesion molecu... 30 1.2 AB101967-1|BAC80526.1| 83|Homo sapiens L1 cell adhesion molecu... 30 1.2 AB101966-1|BAC80525.1| 83|Homo sapiens L1 cell adhesion molecu... 30 1.2 AB101965-1|BAC80524.1| 83|Homo sapiens L1 cell adhesion molecu... 30 1.2 AB101964-1|BAC80523.1| 83|Homo sapiens L1 cell adhesion molecu... 30 1.2 AB101963-1|BAC80522.1| 83|Homo sapiens L1 cell adhesion molecu... 30 1.2 AB101962-1|BAC80521.1| 83|Homo sapiens L1 cell adhesion molecu... 30 1.2 AB101961-1|BAC80520.1| 83|Homo sapiens L1 cell adhesion molecu... 30 1.2 AB101960-1|BAC80519.1| 83|Homo sapiens L1 cell adhesion molecu... 30 1.2 AB101959-1|BAC80518.1| 83|Homo sapiens L1 cell adhesion molecu... 30 1.2 AB101958-1|BAC80517.1| 83|Homo sapiens L1 cell adhesion molecu... 30 1.2 AB101957-1|BAC80516.1| 83|Homo sapiens L1 cell adhesion molecu... 30 1.2 AB101956-1|BAC80515.1| 83|Homo sapiens L1 cell adhesion molecu... 30 1.2 AB101955-1|BAC80514.1| 83|Homo sapiens L1 cell adhesion molecu... 30 1.2 AB101954-1|BAC80513.1| 83|Homo sapiens L1 cell adhesion molecu... 30 1.2 AB101953-1|BAC80512.1| 83|Homo sapiens L1 cell adhesion molecu... 30 1.2 AB101952-1|BAC80511.1| 83|Homo sapiens L1 cell adhesion molecu... 30 1.2 AB101951-1|BAC80510.1| 83|Homo sapiens L1 cell adhesion molecu... 30 1.2 >Z29373-1|CAA82564.1| 1257|Homo sapiens neural cell adhesion molecule L1 protein. Length = 1257 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 182 DERVTMGQNGNLYFANVLTSDNHSD---YIC 209 >X59847-1|CAA42508.1| 1257|Homo sapiens Neural cell adhesion molecule L1 protein. Length = 1257 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 182 DERVTMGQNGNLYFANVLTSDNHSD---YIC 209 >M77640-1|AAC14352.1| 1257|Homo sapiens L1 cell adhesion molecule protein. Length = 1257 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 182 DERVTMGQNGNLYFANVLTSDNHSD---YIC 209 >M74387-1|AAA59476.1| 1253|Homo sapiens cell adhesion molecule L1 protein. Length = 1253 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 182 DERVTMGQNGNLYFANVLTSDNHSD---YIC 209 >EF506611-1|ABP88252.1| 1248|Homo sapiens non-neural L1CAM protein. Length = 1248 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 177 DERVTMGQNGNLYFANVLTSDNHSD---YIC 204 >DQ173642-2|ABC25979.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173641-2|ABC25974.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173640-2|ABC25969.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173639-2|ABC25964.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173638-2|ABC25959.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173637-2|ABC25954.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173636-2|ABC25949.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173635-2|ABC25944.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173634-2|ABC25939.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173633-2|ABC25934.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173632-2|ABC25929.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173631-2|ABC25924.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173630-2|ABC25919.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173629-2|ABC25914.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173628-2|ABC25909.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173627-2|ABC25904.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173626-2|ABC25899.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173625-2|ABC25894.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173624-2|ABC25889.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173623-2|ABC25884.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173622-2|ABC25879.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173621-2|ABC25874.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173620-2|ABC25869.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173619-2|ABC25864.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173618-2|ABC25859.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173617-2|ABC25854.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173616-2|ABC25849.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173615-2|ABC25844.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173614-2|ABC25839.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173613-2|ABC25834.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173612-2|ABC25829.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173611-2|ABC25824.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173610-2|ABC25819.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173609-2|ABC25814.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173608-2|ABC25809.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173607-2|ABC25804.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173606-2|ABC25799.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173605-2|ABC25794.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173604-2|ABC25789.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173603-2|ABC25784.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173602-2|ABC25779.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173601-2|ABC25774.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173600-2|ABC25769.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173599-2|ABC25764.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173598-2|ABC25759.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173597-2|ABC25755.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173596-2|ABC25750.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173595-2|ABC25745.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173594-2|ABC25740.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173593-2|ABC25735.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173592-2|ABC25730.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >DQ173589-1|ABB58724.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >BC126229-1|AAI26230.1| 1257|Homo sapiens L1 cell adhesion molecule protein. Length = 1257 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 182 DERVTMGQNGNLYFANVLTSDNHSD---YIC 209 >AY167726-1|AAO17629.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167725-1|AAO17628.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167724-1|AAO17627.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167723-1|AAO17626.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167722-1|AAO17625.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167721-1|AAO17624.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167720-1|AAO17623.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167719-1|AAO17622.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167718-1|AAO17621.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167717-1|AAO17620.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167716-1|AAO17619.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167715-1|AAO17618.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167714-1|AAO17617.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167713-1|AAO17616.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167712-1|AAO17615.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167711-1|AAO17614.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167710-1|AAO17613.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167709-1|AAO17612.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167708-1|AAO17611.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167707-1|AAO17610.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167706-1|AAO17609.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167705-1|AAO17608.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167704-1|AAO17607.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167703-1|AAO17606.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167702-1|AAO17605.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167701-1|AAO17604.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167700-1|AAO17603.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167699-1|AAO17602.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167698-1|AAO17601.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167697-1|AAO17600.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167696-1|AAO17599.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167695-1|AAO17598.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167694-1|AAO17597.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167693-1|AAO17596.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167692-1|AAO17595.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167691-1|AAO17594.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167690-1|AAO17593.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167689-1|AAO17592.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167688-1|AAO17591.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167687-1|AAO17590.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167686-1|AAO17589.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167685-1|AAO17588.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167684-1|AAO17587.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167683-1|AAO17586.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167682-1|AAO17585.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167681-1|AAO17584.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AY167680-1|AAO17583.1| 534|Homo sapiens L1 cell adhesion molecule protein. Length = 534 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 14 DERVTMGQNGNLYFANVLTSDNHSD---YIC 41 >AB102653-1|BAC81122.1| 1255|Homo sapiens L1 cell adhesion molecule protein. Length = 1255 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 180 DERVTMGQNGNLYFANVLTSDNHSD---YIC 207 >AB101970-1|BAC80529.1| 83|Homo sapiens L1 cell adhesion molecule protein. Length = 83 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 19 DERVTMGQNGNLYFANVLTSDNHSD---YIC 46 >AB101969-1|BAC80528.1| 83|Homo sapiens L1 cell adhesion molecule protein. Length = 83 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 19 DERVTMGQNGNLYFANVLTSDNHSD---YIC 46 >AB101968-1|BAC80527.1| 83|Homo sapiens L1 cell adhesion molecule protein. Length = 83 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 19 DERVTMGQNGNLYFANVLTSDNHSD---YIC 46 >AB101967-1|BAC80526.1| 83|Homo sapiens L1 cell adhesion molecule protein. Length = 83 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 19 DERVTMGQNGNLYFANVLTSDNHSD---YIC 46 >AB101966-1|BAC80525.1| 83|Homo sapiens L1 cell adhesion molecule protein. Length = 83 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 19 DERVTMGQNGNLYFANVLTSDNHSD---YIC 46 >AB101965-1|BAC80524.1| 83|Homo sapiens L1 cell adhesion molecule protein. Length = 83 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 19 DERVTMGQNGNLYFANVLTSDNHSD---YIC 46 >AB101964-1|BAC80523.1| 83|Homo sapiens L1 cell adhesion molecule protein. Length = 83 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 19 DERVTMGQNGNLYFANVLTSDNHSD---YIC 46 >AB101963-1|BAC80522.1| 83|Homo sapiens L1 cell adhesion molecule protein. Length = 83 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 19 DERVTMGQNGNLYFANVLTSDNHSD---YIC 46 >AB101962-1|BAC80521.1| 83|Homo sapiens L1 cell adhesion molecule protein. Length = 83 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 19 DERVTMGQNGNLYFANVLTSDNHSD---YIC 46 >AB101961-1|BAC80520.1| 83|Homo sapiens L1 cell adhesion molecule protein. Length = 83 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 19 DERVTMGQNGNLYFANVLTSDNHSD---YIC 46 >AB101960-1|BAC80519.1| 83|Homo sapiens L1 cell adhesion molecule protein. Length = 83 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 19 DERVTMGQNGNLYFANVLTSDNHSD---YIC 46 >AB101959-1|BAC80518.1| 83|Homo sapiens L1 cell adhesion molecule protein. Length = 83 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 19 DERVTMGQNGNLYFANVLTSDNHSD---YIC 46 >AB101958-1|BAC80517.1| 83|Homo sapiens L1 cell adhesion molecule protein. Length = 83 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 19 DERVTMGQNGNLYFANVLTSDNHSD---YIC 46 >AB101957-1|BAC80516.1| 83|Homo sapiens L1 cell adhesion molecule protein. Length = 83 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 19 DERVTMGQNGNLYFANVLTSDNHSD---YIC 46 >AB101956-1|BAC80515.1| 83|Homo sapiens L1 cell adhesion molecule protein. Length = 83 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 19 DERVTMGQNGNLYFANVLTSDNHSD---YIC 46 >AB101955-1|BAC80514.1| 83|Homo sapiens L1 cell adhesion molecule protein. Length = 83 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 19 DERVTMGQNGNLYFANVLTSDNHSD---YIC 46 >AB101954-1|BAC80513.1| 83|Homo sapiens L1 cell adhesion molecule protein. Length = 83 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 19 DERVTMGQNGNLYFANVLTSDNHSD---YIC 46 >AB101953-1|BAC80512.1| 83|Homo sapiens L1 cell adhesion molecule protein. Length = 83 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 19 DERVTMGQNGNLYFANVLTSDNHSD---YIC 46 >AB101952-1|BAC80511.1| 83|Homo sapiens L1 cell adhesion molecule protein. Length = 83 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 19 DERVTMGQNGNLYFANVLTSDNHSD---YIC 46 >AB101951-1|BAC80510.1| 83|Homo sapiens L1 cell adhesion molecule protein. Length = 83 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 24 DRRITAGPDGNLYF-TIVTKEDVSDICKYVC 113 D R+T G +GNLYF ++T ++ SD Y+C Sbjct: 19 DERVTMGQNGNLYFANVLTSDNHSD---YIC 46 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,003,536 Number of Sequences: 237096 Number of extensions: 121360 Number of successful extensions: 1016 Number of sequences better than 10.0: 126 Number of HSP's better than 10.0 without gapping: 1016 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1016 length of database: 76,859,062 effective HSP length: 19 effective length of database: 72,354,238 effective search space used: 1374730522 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -