BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_O02 (116 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g31870.1 68415.m03894 poly (ADP-ribose) glycohydrolase (PARG)... 25 7.1 >At2g31870.1 68415.m03894 poly (ADP-ribose) glycohydrolase (PARG) family protein similar to poly(ADP-ribose) glycohydrolase [Bos taurus] GI:2062407; contains Pfam domain, PF05028: poly (ADP-ribose) glycohydrolase (PARG) Length = 548 Score = 25.0 bits (52), Expect = 7.1 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 12 VTDFDRRITAGPDGNLYFTIVTKEDVSDICKY 107 + F+R+ITA PD + + +K DVS +C + Sbjct: 210 IVSFERKITAAPDADFW----SKSDVS-LCAF 236 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,893,852 Number of Sequences: 28952 Number of extensions: 17357 Number of successful extensions: 64 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 12,070,560 effective HSP length: 19 effective length of database: 11,520,472 effective search space used: 218888968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -