BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_N24 (584 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 24 1.1 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 22 4.4 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 22 4.4 AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 21 5.8 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 21 5.8 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 23.8 bits (49), Expect = 1.1 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = -3 Query: 414 RAFNFFLTRSVTVHISPTPSIVLPFVSELIKKCQTMDF 301 +AF SVTV +P PS +P +++++ M + Sbjct: 165 QAFGSKYVLSVTVSANPLPSYDIPEINKVVDFINIMSY 202 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.8 bits (44), Expect = 4.4 Identities = 8/20 (40%), Positives = 16/20 (80%) Frame = -3 Query: 396 LTRSVTVHISPTPSIVLPFV 337 ++RSV++ +S P +V+PF+ Sbjct: 550 VSRSVSMALSIGPPLVIPFL 569 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.8 bits (44), Expect = 4.4 Identities = 8/20 (40%), Positives = 16/20 (80%) Frame = -3 Query: 396 LTRSVTVHISPTPSIVLPFV 337 ++RSV++ +S P +V+PF+ Sbjct: 550 VSRSVSMALSIGPPLVIPFL 569 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 21.4 bits (43), Expect = 5.8 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 390 RSVTVHISPTPSIVLPFVSELIKKCQTM 307 +S V + T +I L FVS I CQT+ Sbjct: 176 KSSLVQLILTQAIFLMFVSYNIYVCQTV 203 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 21.4 bits (43), Expect = 5.8 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 390 RSVTVHISPTPSIVLPFVSELIKKCQTM 307 +S V + T +I L FVS I CQT+ Sbjct: 102 KSSLVQLILTQAIFLMFVSYNIYVCQTV 129 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,701 Number of Sequences: 336 Number of extensions: 2525 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14621740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -