BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_N24 (584 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014297-535|AAN13354.1| 209|Drosophila melanogaster CG31488-PA... 28 8.1 AE014296-1986|AAS65029.1| 3135|Drosophila melanogaster CG18331-P... 28 8.1 >AE014297-535|AAN13354.1| 209|Drosophila melanogaster CG31488-PA protein. Length = 209 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = +1 Query: 406 KSTTTARTTNAVIYKSGDSSNTTEDVNPCSPFIPPPARGFSAPGRRISEVK 558 K++ T R+ +YK+ + E ++PC + R F+ P + I E K Sbjct: 8 KTSQTVRSHRNYLYKAFSTLVEREKLSPCEAAVSELYRTFNRPTQYIQETK 58 >AE014296-1986|AAS65029.1| 3135|Drosophila melanogaster CG18331-PA protein. Length = 3135 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +1 Query: 376 NSNGSGQEKIKSTTTARTTNAVIYKSGDSSNTTED 480 +SNG G STTT TT GD S T+ D Sbjct: 1574 SSNGDGNSTQSSTTT--TTTTTTSSDGDQSTTSSD 1606 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,494,165 Number of Sequences: 53049 Number of extensions: 405430 Number of successful extensions: 1262 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1202 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1262 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2338128087 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -