BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_N24 (584 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g41400.1 68418.m05030 zinc finger (C3HC4-type RING finger) fa... 29 3.0 At5g54062.1 68418.m06725 hypothetical protein 28 4.0 At5g60190.1 68418.m07545 Ulp1 protease family protein low simila... 27 7.0 At3g58240.1 68416.m06493 meprin and TRAF homology domain-contain... 27 9.2 >At5g41400.1 68418.m05030 zinc finger (C3HC4-type RING finger) family protein similar to RING-H2 finger protein RHA1a [Arabidopsis thaliana] GI:3790554; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 176 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +1 Query: 265 CCTVSPKQI-NTDEVHRLTFFDQLRNERQDDRWSWGY 372 CC V + N DE+ RLT + + DRW GY Sbjct: 104 CCAVCLHEFENDDEIRRLTNCQHIFHRSCLDRWMMGY 140 >At5g54062.1 68418.m06725 hypothetical protein Length = 207 Score = 28.3 bits (60), Expect = 4.0 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 508 PPARGFSAPGRRISEVKCYEFLWNI 582 P + GFS PG ++ KC+ L NI Sbjct: 31 PTSAGFSLPGSQVDLAKCWSSLLNI 55 >At5g60190.1 68418.m07545 Ulp1 protease family protein low similarity to sentrin/SUMO-specific protease [Homo sapiens] GI:6906859; contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 226 Score = 27.5 bits (58), Expect = 7.0 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -3 Query: 414 RAFNFFLTRSVTVHISPTPSIVLPFVSELIKKCQTMDFV 298 R F+L+ TVH S T S++ P ++ I C +++ Sbjct: 35 RVIEFYLSFLSTVHSSTTISLIPPSIAFWISNCPDTEYL 73 >At3g58240.1 68416.m06493 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 317 Score = 27.1 bits (57), Expect = 9.2 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 244 FTWFFLTCCTVSPKQINTDE 303 FTW C+VSPK I +D+ Sbjct: 9 FTWVIKNFCSVSPKPIYSDQ 28 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,423,692 Number of Sequences: 28952 Number of extensions: 193070 Number of successful extensions: 562 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 562 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1151426952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -