BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_N22 (373 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g14096.1 68417.m02176 F-box family protein contains F-box dom... 28 2.3 At5g04560.1 68418.m00456 DEMETER protein (DME) identical to DEME... 27 3.0 At5g59990.1 68418.m07523 expressed protein ; expression supporte... 27 4.0 At3g47580.1 68416.m05180 leucine-rich repeat transmembrane prote... 26 7.0 At3g27180.1 68416.m03399 expressed protein 26 9.2 At2g35550.2 68415.m04355 expressed protein 26 9.2 At2g35550.1 68415.m04354 expressed protein 26 9.2 >At4g14096.1 68417.m02176 F-box family protein contains F-box domain Pfam:PF00646 Length = 468 Score = 27.9 bits (59), Expect = 2.3 Identities = 18/80 (22%), Positives = 36/80 (45%) Frame = -1 Query: 310 SQKGLHYFKLKLQLIYPSALASPKTAIAGPALIMPFLMLRPIFSIFLKTFHFGSGAAETV 131 S LH + ++ + ++PS + KT + ++ P L ++ LKT + S E Sbjct: 115 SDLDLHVY-METEFVFPSEMFLSKTLVRLKLMLYPLLEFEDVYLPKLKTLYIDSCYFEKY 173 Query: 130 DKARTRANTKKNILEKFIVE 71 T+ + ILE +++ Sbjct: 174 GIGLTKLLSGCPILEDLVLD 193 >At5g04560.1 68418.m00456 DEMETER protein (DME) identical to DEMETER protein [Arabidopsis thaliana] GI:21743571; contains Pfam profile PF00730: HhH-GPD superfamily base excision DNA repair protein Length = 1729 Score = 27.5 bits (58), Expect = 3.0 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -2 Query: 165 LSISAQAQPKLSTKPEPERTRRKISLRSSSLNIVNFNK 52 +S++A+ PKLS+ E ER R + + I+N N+ Sbjct: 789 MSLAARFPPKLSSSREDERNVRSVVVEDPEGCILNLNE 826 >At5g59990.1 68418.m07523 expressed protein ; expression supported by MPSS Length = 241 Score = 27.1 bits (57), Expect = 4.0 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -2 Query: 126 KPEPERTRRKISLRSSSLNIVNFNKRNIELRFICKHHTRGSR 1 K PE + KI S N+ NFNKR +++ C+ SR Sbjct: 157 KYSPEEKKEKIEKYRSKRNLRNFNKR---IKYECRKTLADSR 195 >At3g47580.1 68416.m05180 leucine-rich repeat transmembrane protein kinase, putative protein kinase Xa21 - Oryza sativa, PIR:A57676 Length = 1011 Score = 26.2 bits (55), Expect = 7.0 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +2 Query: 2 RLPRVWCLHINLNSIFRLLKLTIFNDELLKDIFLRVRSGSGFVDS 136 RL ++ L +++N F + I+N L+D+FL GSGF S Sbjct: 208 RLSQMVGLGLSMNKFFGVFPPAIYNLSALEDLFL---FGSGFSGS 249 >At3g27180.1 68416.m03399 expressed protein Length = 518 Score = 25.8 bits (54), Expect = 9.2 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 97 FSSCSLWFWLCRQFRLRLSRNGKSSRKL 180 F SC LW W C R +L+ G S L Sbjct: 88 FDSCRLWGWRC---RAKLAVRGSSDNAL 112 >At2g35550.2 68415.m04355 expressed protein Length = 226 Score = 25.8 bits (54), Expect = 9.2 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -2 Query: 156 SAQAQPKLSTKPEPERTRRKISLRSSSLNIVNFNKR 49 S P + KP+P+R +R +S +S + KR Sbjct: 79 SVNQSPSKALKPKPQRKKRSVSNKSKKTPSIPETKR 114 >At2g35550.1 68415.m04354 expressed protein Length = 271 Score = 25.8 bits (54), Expect = 9.2 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -2 Query: 156 SAQAQPKLSTKPEPERTRRKISLRSSSLNIVNFNKR 49 S P + KP+P+R +R +S +S + KR Sbjct: 124 SVNQSPSKALKPKPQRKKRSVSNKSKKTPSIPETKR 159 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,764,716 Number of Sequences: 28952 Number of extensions: 93398 Number of successful extensions: 317 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 312 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 317 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 497853200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -