SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0001_N21
         (345 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ414246-1|ABD63008.1|  126|Tribolium castaneum odd-skipped prot...    22   2.0  
EU019713-1|ABU25225.1|  528|Tribolium castaneum chitin deacetyla...    20   6.2  
EU019712-1|ABU25224.1|  535|Tribolium castaneum chitin deacetyla...    20   6.2  
AY453651-1|AAR89057.1|  199|Tribolium castaneum serrate protein.       20   6.2  

>DQ414246-1|ABD63008.1|  126|Tribolium castaneum odd-skipped
           protein.
          Length = 126

 Score = 21.8 bits (44), Expect = 2.0
 Identities = 10/33 (30%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = +1

Query: 43  KYGTR-YGASLRKMVKKMEVTQHAKYTCSFCGK 138
           KY  R +  S   ++ +   T    Y+C  CGK
Sbjct: 83  KYCNRQFTKSYNLLIHERTHTDERPYSCDICGK 115


>EU019713-1|ABU25225.1|  528|Tribolium castaneum chitin deacetylase
           2B protein.
          Length = 528

 Score = 20.2 bits (40), Expect = 6.2
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +3

Query: 15  THQEGRNYW 41
           TH+E  NYW
Sbjct: 251 THKEDPNYW 259


>EU019712-1|ABU25224.1|  535|Tribolium castaneum chitin deacetylase
           2A protein.
          Length = 535

 Score = 20.2 bits (40), Expect = 6.2
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +3

Query: 15  THQEGRNYW 41
           TH+E  NYW
Sbjct: 258 THKEDPNYW 266


>AY453651-1|AAR89057.1|  199|Tribolium castaneum serrate protein.
          Length = 199

 Score = 20.2 bits (40), Expect = 6.2
 Identities = 5/13 (38%), Positives = 8/13 (61%)
 Frame = -3

Query: 142 HPCRRMSKCISRV 104
           +PCR    C+ R+
Sbjct: 113 NPCRNNGSCVDRI 125


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 72,694
Number of Sequences: 336
Number of extensions: 1501
Number of successful extensions: 5
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 50
effective length of database: 105,785
effective search space used:  6770240
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.3 bits)

- SilkBase 1999-2023 -