BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_N21 (345 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_07_0070 + 27479654-27479672,27479864-27479922,27480339-274803... 131 1e-31 01_06_0260 - 27959188-27959251,27959342-27959424,27960220-279603... 130 3e-31 07_03_0481 - 18572206-18574314,18574591-18575185,18575304-185753... 29 1.3 12_01_0151 - 1158834-1159703,1159917-1160092,1160144-1162097,116... 28 1.7 07_01_0385 - 2871628-2872131 28 2.3 12_02_0648 + 21490202-21490296,21490547-21490634,21491216-214912... 27 3.0 07_03_1237 + 25073010-25073513 27 5.2 06_03_0749 + 24133302-24134274,24134585-24135272,24135751-241358... 27 5.2 >05_07_0070 + 27479654-27479672,27479864-27479922,27480339-27480378, 27480477-27480565,27481065-27481147,27481219-27481282 Length = 117 Score = 131 bits (317), Expect = 1e-31 Identities = 57/89 (64%), Positives = 69/89 (77%) Frame = +1 Query: 4 KMAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKR 183 ++ KRTKK GI GKYGTRYGASLRK +KKMEV+QH+KY C FCGK A+KR VGIW CK Sbjct: 25 ELTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKFAVKRKAVGIWGCKD 84 Query: 184 CKRTVAGGAWVFSTTAASSCRSAVRRLRE 270 C + AGGA+ +T +A + RS +RRLRE Sbjct: 85 CGKVKAGGAYTMNTASAVTVRSTIRRLRE 113 >01_06_0260 - 27959188-27959251,27959342-27959424,27960220-27960308, 27960388-27960427,27960938-27960981,27961240-27961288 Length = 122 Score = 130 bits (314), Expect = 3e-31 Identities = 57/86 (66%), Positives = 67/86 (77%) Frame = +1 Query: 13 KRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCKR 192 KRTKK GI GKYGTRYGASLRK +KKMEV+QH+KY C FCGK A+KR VGIW CK C + Sbjct: 33 KRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKFAVKRKAVGIWGCKDCGK 92 Query: 193 TVAGGAWVFSTTAASSCRSAVRRLRE 270 AGGA+ +T +A + RS +RRLRE Sbjct: 93 VKAGGAYTMNTASAVTVRSTIRRLRE 118 >07_03_0481 - 18572206-18574314,18574591-18575185,18575304-18575371, 18577344-18577458,18578179-18578333,18578673-18580621, 18580691-18581372,18581550-18581621,18582558-18583199, 18583301-18583402,18585011-18585100 Length = 2192 Score = 28.7 bits (61), Expect = 1.3 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +1 Query: 130 CGKDAMKRSCVGIWSCKRCKRTVAGGAWVFSTTAASSCRSAVRRLR 267 C +KR+ G W C RC+ + + A +S R RR+R Sbjct: 58 CLNPPLKRAPPGNWQCPRCRTKKVSLKLLDNADADTSKRERTRRMR 103 >12_01_0151 - 1158834-1159703,1159917-1160092,1160144-1162097, 1162360-1162620,1162729-1162916,1164127-1164166 Length = 1162 Score = 28.3 bits (60), Expect = 1.7 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 105 LSYFHLFDHFT*RCTITCAIF 43 LSYFHL DH +C + C+IF Sbjct: 314 LSYFHLPDHLK-QCFVYCSIF 333 >07_01_0385 - 2871628-2872131 Length = 167 Score = 27.9 bits (59), Expect = 2.3 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +1 Query: 115 YTCSFCGKDAMKRSCVGIWSCKRCKRTVAGGAW 213 + C FC K K +G K VAGG+W Sbjct: 47 FPCLFCAKTFRKSQALGGHQNAHRKERVAGGSW 79 >12_02_0648 + 21490202-21490296,21490547-21490634,21491216-21491260, 21491355-21491387,21491480-21491557,21491647-21491690, 21491765-21491805,21492102-21492184,21492261-21492352, 21492468-21492537,21492838-21492876,21493670-21493687, 21494586-21494713,21495235-21495358,21495585-21495716, 21496092-21496223,21496582-21496665 Length = 441 Score = 27.5 bits (58), Expect = 3.0 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 94 EVTQHAKYTCSFCGKDAM 147 E+ +H KYTC C K A+ Sbjct: 194 EMVEHNKYTCPICSKTAL 211 >07_03_1237 + 25073010-25073513 Length = 167 Score = 26.6 bits (56), Expect = 5.2 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 148 KRSCVGIWSCKRCKRTVAGGAWVFSTTAASSC 243 KR G+ C C RT++GG++ + ++C Sbjct: 24 KRGAAGV--CNVCDRTISGGSYGYRCGGGAAC 53 >06_03_0749 + 24133302-24134274,24134585-24135272,24135751-24135857, 24137565-24137815 Length = 672 Score = 26.6 bits (56), Expect = 5.2 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -3 Query: 193 FSCTVYMTRCLHMNVSWHPCRRMSKCISRVELLPSF 86 + C+V CL V HPC +S S +++ F Sbjct: 613 YICSVARANCLPSPVPSHPCAHVSLSTSAIQITLQF 648 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,184,700 Number of Sequences: 37544 Number of extensions: 149148 Number of successful extensions: 409 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 400 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 409 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 494158076 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -