BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_N20 (425 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g24150.1 68416.m03032 expressed protein 27 4.0 At1g52780.1 68414.m05966 expressed protein 27 5.3 >At3g24150.1 68416.m03032 expressed protein Length = 343 Score = 27.5 bits (58), Expect = 4.0 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +1 Query: 301 PSIFSGESVENEVPSYDFPFVSRSQWSARQPNQTLPLKTPV 423 P I S PSY + ++Q S+ +P+QT+ PV Sbjct: 137 PKIQEPVSASTNEPSYHHEYRQQAQQSSTKPSQTVQAAVPV 177 >At1g52780.1 68414.m05966 expressed protein Length = 1059 Score = 27.1 bits (57), Expect = 5.3 Identities = 19/65 (29%), Positives = 30/65 (46%) Frame = +1 Query: 184 LLFKKYCNNRVLCIVLKVIMFNILSIGLFVTIIMNVKAYPSIFSGESVENEVPSYDFPFV 363 LLF N L V ++M + ++G + +I +A + + E PSYD + Sbjct: 759 LLFYVSSNTDSLPFV-SLVMLGVQALGYSLPLITGAEALFKRKAASATTYETPSYD---L 814 Query: 364 SRSQW 378 RSQW Sbjct: 815 QRSQW 819 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,880,289 Number of Sequences: 28952 Number of extensions: 161471 Number of successful extensions: 418 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 418 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 665183504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -