BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_N19 (500 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39807| Best HMM Match : Ribosomal_S8e (HMM E-Value=0) 215 2e-56 SB_22712| Best HMM Match : Ribosomal_S8e (HMM E-Value=0.068) 54 7e-08 SB_47353| Best HMM Match : Neur_chan_memb (HMM E-Value=3.2) 31 0.53 SB_30690| Best HMM Match : Neur_chan_memb (HMM E-Value=4.3e-09) 31 0.53 SB_37792| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_17079| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) 28 3.8 SB_42723| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_1004| Best HMM Match : CPSase_sm_chain (HMM E-Value=0) 27 6.6 SB_58821| Best HMM Match : RecR (HMM E-Value=1.6) 27 6.6 SB_42525| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_37037| Best HMM Match : PSI (HMM E-Value=0.061) 27 8.7 >SB_39807| Best HMM Match : Ribosomal_S8e (HMM E-Value=0) Length = 192 Score = 215 bits (524), Expect = 2e-56 Identities = 100/149 (67%), Positives = 120/149 (80%) Frame = +2 Query: 53 PIRKKRKYELGRPAANTKLGPQRIHLVRSRGGNTKYRALRLDTGNFAWGSECSTRKTRII 232 P+R KRK+ELGRP ANTK+G +RIH VR+RGGN K+RA RLDT NF+WGSE TRK RII Sbjct: 4 PLRHKRKFELGRPPANTKIGTKRIHEVRTRGGNRKFRAFRLDTENFSWGSESCTRKARII 63 Query: 233 DVVYNASNNELVRTKTLVKNAIVVVDATPFRQWYESHYLLPLGRKKGAKLTEAEEAIINE 412 DVVYNASNNELVRTKTLVKN IV VD+TPFRQWYE+HY +P+GRKK + TE E+ I+N+ Sbjct: 64 DVVYNASNNELVRTKTLVKNCIVQVDSTPFRQWYEAHYAIPIGRKKTKQPTEEEQEILNK 123 Query: 413 KRSRKTAKKYLSRQRLSKVEGGLEEQFHT 499 KRS +K +R+ +KV G+EEQF T Sbjct: 124 KRSNHCTRKLEARKANAKVAPGMEEQFVT 152 >SB_22712| Best HMM Match : Ribosomal_S8e (HMM E-Value=0.068) Length = 147 Score = 54.0 bits (124), Expect = 7e-08 Identities = 24/77 (31%), Positives = 46/77 (59%) Frame = +2 Query: 113 PQRIHLVRSRGGNTKYRALRLDTGNFAWGSECSTRKTRIIDVVYNASNNELVRTKTLVKN 292 P++I ++ GG+TK +ALR++ G + S+ + I+ V+++ +N E + +VK Sbjct: 37 PEKIKERKAYGGHTKIKALRVNKGVYTLKSQGVEVEAPILSVMHSFANKEHIERNVIVKG 96 Query: 293 AIVVVDATPFRQWYESH 343 +IV VD PF W++ + Sbjct: 97 SIVQVDNKPFEDWFQEY 113 >SB_47353| Best HMM Match : Neur_chan_memb (HMM E-Value=3.2) Length = 133 Score = 31.1 bits (67), Expect = 0.53 Identities = 16/56 (28%), Positives = 28/56 (50%) Frame = +2 Query: 305 VDATPFRQWYESHYLLPLGRKKGAKLTEAEEAIINEKRSRKTAKKYLSRQRLSKVE 472 + A R+W+E K+ A+L +I+ + K AK+Y+ +QRL +E Sbjct: 53 IKANNARKWWEKEMRANQTAKELARLASWRTWVISGETVEKKAKQYVFKQRLQDIE 108 >SB_30690| Best HMM Match : Neur_chan_memb (HMM E-Value=4.3e-09) Length = 193 Score = 31.1 bits (67), Expect = 0.53 Identities = 16/56 (28%), Positives = 28/56 (50%) Frame = +2 Query: 305 VDATPFRQWYESHYLLPLGRKKGAKLTEAEEAIINEKRSRKTAKKYLSRQRLSKVE 472 + A R+W+E K+ A+L +I+ + K AK+Y+ +QRL +E Sbjct: 87 IKANNARKWWEKEMRANQTAKELARLASWRTWVISGETVEKKAKQYVFKQRLQDIE 142 >SB_37792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 230 Score = 29.5 bits (63), Expect = 1.6 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +2 Query: 212 TRKTRIIDVVYNASNNELVRTKTLVKNAIVVVDATPFR 325 T++ +I D++ N N VR +TL+ NA +++D F+ Sbjct: 18 TKRKKIADILSNEIRN--VRERTLILNAALIIDICVFK 53 >SB_17079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2537 Score = 29.1 bits (62), Expect = 2.2 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +2 Query: 29 RATGGKRAPIRKKRKYELGRPAANTKLGP 115 R GG R P+++ +E +P+ N + GP Sbjct: 769 RRGGGSRVPVKRSSSFENRKPSPNRRRGP 797 >SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1327 Score = 28.3 bits (60), Expect = 3.8 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = +2 Query: 320 FRQWYESHYLLPLGRKKGAKLTEAEEAIINEKRSRKTAKKYLSRQRLSKVE 472 F Q H++ +KKG + + A+ +R + AK+ LS Q ++VE Sbjct: 930 FDQNVMEHFIKLYKKKKGKNIRKDNRAVQKLRREVEKAKRALSTQHQARVE 980 >SB_42723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 312 Score = 27.5 bits (58), Expect = 6.6 Identities = 9/20 (45%), Positives = 17/20 (85%) Frame = +1 Query: 400 HHKRKTQSKDSEEVPEQAAP 459 H ++KT+++++E+VPE A P Sbjct: 129 HEEKKTKARNNEKVPEGAVP 148 >SB_1004| Best HMM Match : CPSase_sm_chain (HMM E-Value=0) Length = 2007 Score = 27.5 bits (58), Expect = 6.6 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +3 Query: 297 LSWWMPHLSGSGMKATTCCHSEGRKVPSSLRL 392 L+ WM HL + CH+EGR + L L Sbjct: 1881 LTIWMKHLENWPLHMPIVCHAEGRTTAAILLL 1912 >SB_58821| Best HMM Match : RecR (HMM E-Value=1.6) Length = 223 Score = 27.5 bits (58), Expect = 6.6 Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = +2 Query: 335 ESHYLL--PLGRKKGAKLTEAEEAIINEKRSR 424 E H+LL PL +KK KLT+ E I N K +R Sbjct: 125 EDHFLLHCPLYKKKREKLTKTMEEIENVKFTR 156 >SB_42525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 27.1 bits (57), Expect = 8.7 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = -2 Query: 139 GSD*VDALGTKLSVGSRAT*LILPLLTNGRTFAARSPPLMPMITTD 2 GS +D L +L+ G R T + L +GR + SPPL+ I D Sbjct: 15 GSGDLDYLERQLNCGLRTT--AVTWLHSGRVVSRNSPPLLGHIVND 58 >SB_37037| Best HMM Match : PSI (HMM E-Value=0.061) Length = 284 Score = 27.1 bits (57), Expect = 8.7 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 222 LVLLMLFIMPLTMNWCVPKPW*RMLLSW 305 LVLL+L ++ LT CV W + SW Sbjct: 213 LVLLLLCVVGLTTTVCVANEWHFKIYSW 240 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,607,335 Number of Sequences: 59808 Number of extensions: 386806 Number of successful extensions: 821 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 779 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 821 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1087245449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -