BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_N15 (546 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z46242-15|CAA86337.2| 2507|Caenorhabditis elegans Hypothetical p... 28 3.8 Z35598-8|CAA84657.2| 2507|Caenorhabditis elegans Hypothetical pr... 28 3.8 >Z46242-15|CAA86337.2| 2507|Caenorhabditis elegans Hypothetical protein F10F2.1 protein. Length = 2507 Score = 28.3 bits (60), Expect = 3.8 Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Frame = +3 Query: 165 FSELQREDFLPVLAAARRHEPDQLAIAMASMCCE-DKPV-SLFQCRIKLFNDWYPTWSEE 338 F++L + P + + D L +++AS + KP+ +L + R K FND Y +W ++ Sbjct: 1854 FNDLSQYPVFPWILT--NYTSDTLDLSVASNFRDLSKPIGALSEARRKFFNDRYTSWDDD 1911 Query: 339 E 341 + Sbjct: 1912 Q 1912 >Z35598-8|CAA84657.2| 2507|Caenorhabditis elegans Hypothetical protein F10F2.1 protein. Length = 2507 Score = 28.3 bits (60), Expect = 3.8 Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Frame = +3 Query: 165 FSELQREDFLPVLAAARRHEPDQLAIAMASMCCE-DKPV-SLFQCRIKLFNDWYPTWSEE 338 F++L + P + + D L +++AS + KP+ +L + R K FND Y +W ++ Sbjct: 1854 FNDLSQYPVFPWILT--NYTSDTLDLSVASNFRDLSKPIGALSEARRKFFNDRYTSWDDD 1911 Query: 339 E 341 + Sbjct: 1912 Q 1912 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,953,377 Number of Sequences: 27780 Number of extensions: 239609 Number of successful extensions: 695 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 656 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 695 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1102518352 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -