BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_N11 (631 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 26 0.30 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 22 4.9 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 21 8.5 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 21 8.5 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 21 8.5 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 8.5 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 25.8 bits (54), Expect = 0.30 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -2 Query: 603 FLRVFHIL*FFIFVTTVRHFVNIVIFCQNV*NIGTVCF 490 FL+V + L F+ +T F N VI I +CF Sbjct: 12 FLKVMYKLSHFLSITPNYDFENFVIISPRCDKISAICF 49 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 21.8 bits (44), Expect = 4.9 Identities = 6/20 (30%), Positives = 12/20 (60%) Frame = -2 Query: 576 FFIFVTTVRHFVNIVIFCQN 517 FF+ + + F+N ++ C N Sbjct: 139 FFVILLWISFFLNFMLHCNN 158 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 21.0 bits (42), Expect = 8.5 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -3 Query: 488 TIPIKLSVFVPYFSVLFVFASKTYIPSLA 402 T+ + VFV F++ ++YIP L+ Sbjct: 176 TLSDRYKVFVDLFNLSTFLIPRSYIPPLS 204 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.0 bits (42), Expect = 8.5 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -3 Query: 488 TIPIKLSVFVPYFSVLFVFASKTYIPSLA 402 T+ + VFV F++ ++YIP L+ Sbjct: 336 TLSDRYKVFVDLFNLSTFLIPRSYIPPLS 364 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.0 bits (42), Expect = 8.5 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -3 Query: 488 TIPIKLSVFVPYFSVLFVFASKTYIPSLA 402 T+ + VFV F++ ++YIP L+ Sbjct: 336 TLSDRYKVFVDLFNLSTFLIPRSYIPPLS 364 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.0 bits (42), Expect = 8.5 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 337 KILETGTDASATNDDTTEVYFS 402 +++ GT + D TEVYFS Sbjct: 79 EMIHRGTFQGDIHRDLTEVYFS 100 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.315 0.134 0.365 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,457 Number of Sequences: 336 Number of extensions: 2681 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16188355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits)
- SilkBase 1999-2023 -