BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_N11 (631 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF203339-1|AAF19834.1| 156|Anopheles gambiae immune-responsive ... 28 0.28 DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. 25 1.5 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 23 8.0 >AF203339-1|AAF19834.1| 156|Anopheles gambiae immune-responsive serpin-related proteinISerpF1 protein. Length = 156 Score = 27.9 bits (59), Expect = 0.28 Identities = 10/40 (25%), Positives = 24/40 (60%) Frame = +1 Query: 58 GLIKAAPVTENNDEKLIVSSELFINEFVQYSSKYDIVSLT 177 GL+ + +N D L +++ F+++F++ +KY ++ T Sbjct: 4 GLLLESAQQDNKDYDLNIATNFFVDDFIEVINKYQQIANT 43 >DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. Length = 409 Score = 25.4 bits (53), Expect = 1.5 Identities = 8/31 (25%), Positives = 20/31 (64%) Frame = +1 Query: 85 ENNDEKLIVSSELFINEFVQYSSKYDIVSLT 177 +N D L +++ F+++F++ +KY ++ T Sbjct: 112 DNKDYDLNIATNFFVDDFIEVINKYQQIANT 142 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 23.0 bits (47), Expect = 8.0 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -2 Query: 462 RSIFFSLICFRIENVYTI 409 RS+ LIC R+EN+ T+ Sbjct: 90 RSLDSRLICVRLENIATL 107 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.315 0.134 0.365 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 583,850 Number of Sequences: 2352 Number of extensions: 11668 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61468785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits)
- SilkBase 1999-2023 -