BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_N09 (485 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 24 0.99 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 7.0 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 23.8 bits (49), Expect = 0.99 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +2 Query: 149 RQQIRLNQLHLTKFRLKYPFTAPTRVVRK 235 R+ I +N LH + L YPF R+V K Sbjct: 200 REDIGIN-LHHWHWHLVYPFEGDIRIVNK 227 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.0 bits (42), Expect = 7.0 Identities = 10/37 (27%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +1 Query: 142 CFAATNSPQPTPFN---KIPPKIPFYSTHTCCQKSVD 243 CFA + P ++PP P Y + C +D Sbjct: 447 CFAQDDGLCPYTLKHKIRVPPGTPIYECNKRCNCDID 483 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,458 Number of Sequences: 438 Number of extensions: 2268 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13297932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -