BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_N06 (610 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 24 4.4 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 23.8 bits (49), Expect = 4.4 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 271 TEYFFMLSPILNSCRYFYP 327 T +F+ML PI+ YF P Sbjct: 305 TFFFYMLPPIILDAGYFMP 323 Score = 23.0 bits (47), Expect = 7.7 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 213 ILGVLYRYSGGFDLSFTAYN*ILFHVVPHI 302 I+GVL RY+ +S N F+++P I Sbjct: 285 IIGVLLRYATNLHVSPLTPNTFFFYMLPPI 314 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 580,879 Number of Sequences: 2352 Number of extensions: 12296 Number of successful extensions: 13 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -