BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_N03 (543 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11644| Best HMM Match : Pox_A32 (HMM E-Value=0.026) 28 4.3 SB_22369| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 >SB_11644| Best HMM Match : Pox_A32 (HMM E-Value=0.026) Length = 1532 Score = 28.3 bits (60), Expect = 4.3 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -3 Query: 499 EGSGWVHVSVPTHAYNRKALRIAGIGNYKWHQPT 398 +G W S P+ A+ R+ + G+G Y W + T Sbjct: 1361 QGRRWRPHSRPSSAFRRQRFALPGLGCYPWSKQT 1394 >SB_22369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 27.5 bits (58), Expect = 7.5 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 404 LVPLVISYTRDSKSFPVVRVSGHANVHPTGSFIYFCV 514 L + S RDS S V + GHA H T + ++ CV Sbjct: 22 LASMTFSKCRDSMSIYDVALIGHAYKHVTATSLHDCV 58 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,929,305 Number of Sequences: 59808 Number of extensions: 296471 Number of successful extensions: 510 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 484 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 510 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1239956166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -