BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_N03 (543 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g41170.1 68415.m05085 F-box family protein contains Pfam PF00... 27 6.1 At5g39940.1 68418.m04843 expressed protein 27 8.1 >At2g41170.1 68415.m05085 F-box family protein contains Pfam PF00646: F-box domain; similar to SKP1 interacting partner 2 (SKIP2) TIGR_Ath1:At5g67250 Length = 371 Score = 27.5 bits (58), Expect = 6.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 358 GVNNGHLDSDYNVVGHRQLMATDXPWSKTL 269 GV N DSD NVV + + PW +T+ Sbjct: 300 GVQNCRCDSDENVVMEFRQFRPESPWRRTV 329 >At5g39940.1 68418.m04843 expressed protein Length = 480 Score = 27.1 bits (57), Expect = 8.1 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 364 RCGVNNGHLDSDYNVVGH 311 RC V NGH + N+ GH Sbjct: 91 RCNVTNGHCNDTINLAGH 108 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,353,040 Number of Sequences: 28952 Number of extensions: 206212 Number of successful extensions: 389 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 385 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 389 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1013649368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -