BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= I09A02NGRL0001_M19
(365 letters)
Database: celegans
27,780 sequences; 12,740,198 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
U41263-13|AAC24428.2| 1844|Caenorhabditis elegans Hypothetical p... 26 7.2
>U41263-13|AAC24428.2| 1844|Caenorhabditis elegans Hypothetical
protein T19D12.1 protein.
Length = 1844
Score = 26.2 bits (55), Expect = 7.2
Identities = 14/61 (22%), Positives = 28/61 (45%)
Frame = +3
Query: 168 TINSDGTSGAMVKVPITGNENHKLSALGSVDLTNQIKLGAVTAGLVYDNVNRHGATLTNT 347
T+ + G++G+ V P T + S+ S+ + G+ T+G +T TN+
Sbjct: 1548 TVPNTGSTGSTVTNPSTSSSTSGSSSTQSIPSSTAANTGSSTSGPTVATTQGSSSTQTNS 1607
Query: 348 H 350
+
Sbjct: 1608 N 1608
Database: celegans
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 12,740,198
Number of sequences in database: 27,780
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,157,071
Number of Sequences: 27780
Number of extensions: 116174
Number of successful extensions: 233
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 233
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 233
length of database: 12,740,198
effective HSP length: 73
effective length of database: 10,712,258
effective search space used: 514188384
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -