BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_M19 (365 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41263-13|AAC24428.2| 1844|Caenorhabditis elegans Hypothetical p... 26 7.2 >U41263-13|AAC24428.2| 1844|Caenorhabditis elegans Hypothetical protein T19D12.1 protein. Length = 1844 Score = 26.2 bits (55), Expect = 7.2 Identities = 14/61 (22%), Positives = 28/61 (45%) Frame = +3 Query: 168 TINSDGTSGAMVKVPITGNENHKLSALGSVDLTNQIKLGAVTAGLVYDNVNRHGATLTNT 347 T+ + G++G+ V P T + S+ S+ + G+ T+G +T TN+ Sbjct: 1548 TVPNTGSTGSTVTNPSTSSSTSGSSSTQSIPSSTAANTGSSTSGPTVATTQGSSSTQTNS 1607 Query: 348 H 350 + Sbjct: 1608 N 1608 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,157,071 Number of Sequences: 27780 Number of extensions: 116174 Number of successful extensions: 233 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 233 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 233 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 514188384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -