SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0001_M19
         (365 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U41263-13|AAC24428.2| 1844|Caenorhabditis elegans Hypothetical p...    26   7.2  

>U41263-13|AAC24428.2| 1844|Caenorhabditis elegans Hypothetical
            protein T19D12.1 protein.
          Length = 1844

 Score = 26.2 bits (55), Expect = 7.2
 Identities = 14/61 (22%), Positives = 28/61 (45%)
 Frame = +3

Query: 168  TINSDGTSGAMVKVPITGNENHKLSALGSVDLTNQIKLGAVTAGLVYDNVNRHGATLTNT 347
            T+ + G++G+ V  P T +     S+  S+  +     G+ T+G          +T TN+
Sbjct: 1548 TVPNTGSTGSTVTNPSTSSSTSGSSSTQSIPSSTAANTGSSTSGPTVATTQGSSSTQTNS 1607

Query: 348  H 350
            +
Sbjct: 1608 N 1608


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,157,071
Number of Sequences: 27780
Number of extensions: 116174
Number of successful extensions: 233
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 233
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 233
length of database: 12,740,198
effective HSP length: 73
effective length of database: 10,712,258
effective search space used: 514188384
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -