BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_M18 (603 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 3.0 AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 22 5.3 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.6 bits (46), Expect = 3.0 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = +2 Query: 479 GHPDQMCDQISDAILDAHLKQDPNAKVACETVTKTGNG 592 G D++C + +L + DP+ + +T GNG Sbjct: 1717 GMEDEICPYATFHLLGFREEMDPSKAMQFQTFPHPGNG 1754 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 21.8 bits (44), Expect = 5.3 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 47 KYLNNIS*KLINHKCLFSGLVTKVKASQLLV 139 K +++IS L+N K F L V A LLV Sbjct: 18 KEIHSISDSLVNAKLAFGFLDNSVWADGLLV 48 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,918 Number of Sequences: 438 Number of extensions: 3569 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17726685 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -