Samia BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0001_M17
         (210 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic ac...    19   4.9  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              19   8.5  

>AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha7-1 protein.
          Length = 555

 Score = 19.4 bits (38), Expect = 4.9
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -2

Query: 83  TRFPIDNQRDELR 45
           T FP D+QR E++
Sbjct: 153 TWFPFDDQRCEMK 165



 Score = 19.0 bits (37), Expect = 6.4
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = -3

Query: 28  GHSHLHVS 5
           GHSH+H +
Sbjct: 422 GHSHIHAT 429


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 18.6 bits (36), Expect = 8.5
 Identities = 9/31 (29%), Positives = 12/31 (38%)
 Frame = +2

Query: 2    SRNMKVTVTGGGGFLGARLADYLLENECPLR 94
            +RN  V   G  G     +   +  NE P R
Sbjct: 1895 NRNYGVNARGKDGMTTEEMRKLIERNEAPSR 1925


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.314    0.133    0.419 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 31,850
Number of Sequences: 438
Number of extensions: 396
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 45
effective length of database: 126,633
effective search space used:  3039192
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 36 (19.2 bits)