BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_M14 (408 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF525673-1|AAM82611.1| 60|Anopheles gambiae cecropin CecB prot... 26 0.46 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 24 2.5 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 24 2.5 CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 22 9.9 >AF525673-1|AAM82611.1| 60|Anopheles gambiae cecropin CecB protein. Length = 60 Score = 26.2 bits (55), Expect = 0.46 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Frame = +3 Query: 66 MNFTKIILLV-VACVFAMGT--VSAAP-WNPF*ELEKVGQRM 179 MNFTK+ +LV +A + +G V AP W LEK+G+ + Sbjct: 1 MNFTKLFILVAIAVLVVVGVQPVDGAPRWKFGKRLEKLGRNV 42 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.8 bits (49), Expect = 2.5 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 227 LGHCSDGWTSTYDCVS 180 L HCSDGW T V+ Sbjct: 417 LVHCSDGWDRTPQIVA 432 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.8 bits (49), Expect = 2.5 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 227 LGHCSDGWTSTYDCVS 180 L HCSDGW T V+ Sbjct: 417 LVHCSDGWDRTPQIVA 432 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 21.8 bits (44), Expect = 9.9 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +1 Query: 97 SLASSLWGPFRRRRGIPS 150 ++ +S +GP RRR G P+ Sbjct: 381 TVRASSFGPMRRRSGSPT 398 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 348,583 Number of Sequences: 2352 Number of extensions: 6335 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 32922351 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -