BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_M12 (542 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 23 2.0 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 23 2.0 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 23 2.0 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 23 2.0 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 23 2.0 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 23 2.0 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 23 2.0 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 23 2.0 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 23 2.0 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 23 2.7 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 4.6 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 6.1 L01588-1|AAA27735.1| 74|Apis mellifera zinc finger protein pro... 21 8.1 AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding prote... 21 8.1 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 407 HNNNHDFSAKAFATKNMPNIPQVP 478 +NNN++ + K N+ NI Q+P Sbjct: 97 YNNNYNTNYKKLQYYNIINIEQIP 120 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 407 HNNNHDFSAKAFATKNMPNIPQVP 478 +NNN++ + K N+ NI Q+P Sbjct: 97 YNNNYNTNYKKLQYYNIINIEQIP 120 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 407 HNNNHDFSAKAFATKNMPNIPQVP 478 +NNN++ + K N+ NI Q+P Sbjct: 97 YNNNYNTNYKKLQYYNIINIEQIP 120 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 407 HNNNHDFSAKAFATKNMPNIPQVP 478 +NNN++ + K N+ NI Q+P Sbjct: 97 YNNNYNTNYKKLQYYNIINIEQIP 120 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 407 HNNNHDFSAKAFATKNMPNIPQVP 478 +NNN++ + K N+ NI Q+P Sbjct: 97 YNNNYNTNYKKLQYYNIINIEQIP 120 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 407 HNNNHDFSAKAFATKNMPNIPQVP 478 +NNN++ + K N+ NI Q+P Sbjct: 97 YNNNYNTNYKKLQYYNIINIEQIP 120 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 407 HNNNHDFSAKAFATKNMPNIPQVP 478 +NNN++ + K N+ NI Q+P Sbjct: 101 YNNNYNTNYKKLQYYNIINIEQIP 124 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 407 HNNNHDFSAKAFATKNMPNIPQVP 478 +NNN++ + K N+ NI Q+P Sbjct: 97 YNNNYNTNYKKLQYYNIINIEQIP 120 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.0 bits (47), Expect = 2.0 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = +2 Query: 398 NLFHNNNHDFSAKAFATKNMPNIPQVP 478 N ++ NN++++ K + + NI Q+P Sbjct: 102 NKYNYNNNNYNKKLYYKNYIINIEQIP 128 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +1 Query: 415 QPRFQCQSIRH*KHAKYSSSSELQHCR 495 QP F+C+ + +Y S+ L H R Sbjct: 418 QPAFRCKPSQRFASGRYYSAYSLHHVR 444 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.8 bits (44), Expect = 4.6 Identities = 9/28 (32%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 398 NLFHNNNHD-FSAKAFATKNMPNIPQVP 478 N ++NNN++ ++ K + + NI Q+P Sbjct: 331 NNYNNNNYNNYNKKLYYKNYIINIEQIP 358 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.4 bits (43), Expect = 6.1 Identities = 10/45 (22%), Positives = 17/45 (37%) Frame = +2 Query: 398 NLFHNNNHDFSAKAFATKNMPNIPQVPNFNTVGAGVDYMFKDQIG 532 +L N N DF + P++ P ++ G D +G Sbjct: 349 HLISNENRDFQTTPTVSVEQPHLFLYPEVSSTYTGFGIQSTDFVG 393 >L01588-1|AAA27735.1| 74|Apis mellifera zinc finger protein protein. Length = 74 Score = 21.0 bits (42), Expect = 8.1 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -2 Query: 514 HVVHSGTDSVEVRNLRNIWHVFSGE 440 H H V+V NLR V +GE Sbjct: 39 HCSHCDRQFVQVANLRRHLRVHTGE 63 >AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding protein ASP5 protein. Length = 143 Score = 21.0 bits (42), Expect = 8.1 Identities = 12/39 (30%), Positives = 25/39 (64%) Frame = -2 Query: 130 LRLILILFDVVTRLFNKHVTAVDADQENRH*EQLSEHLR 14 ++ +L+L +VT + K V ++ ADQ E+L++++R Sbjct: 3 VKSVLLLITIVTFVALKPVKSMSADQV----EKLAKNMR 37 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,958 Number of Sequences: 438 Number of extensions: 3277 Number of successful extensions: 17 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15459066 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -