BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_M10 (545 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC14G10.02 ||SPCC18B5.13|ribosome biogenesis protein Urb1|Schi... 31 0.084 SPBC6B1.09c |nbs1||Mre11 complex subunit Nbs1|Schizosaccharomyce... 29 0.45 SPBC17F3.02 |nak1|orb3, mor4|PAK-related kinase Nak1|Schizosacch... 28 0.78 SPBC2G2.11 |||N-myristoyltransferase 1|Schizosaccharomyces pombe... 28 1.0 SPAC3H1.11 |hsr1||transcription factor Hsr1|Schizosaccharomyces ... 25 5.5 SPBC649.05 |cut12|stf1|spindle pole body protein Cut12 |Schizosa... 25 7.3 SPAC19G12.15c |tpp1||trehalose-6-phosphate phosphatase Tpp1|Schi... 25 7.3 SPBC36.12c |git7||SGT1-like protein Git7|Schizosaccharomyces pom... 25 7.3 SPBC36.07 |iki3||RNA polymerase II elongator subunit Iki3 |Schiz... 25 9.6 SPAC2E12.02 |hsf1|hstf, hsf|transcription factor Hsf1|Schizosacc... 25 9.6 >SPCC14G10.02 ||SPCC18B5.13|ribosome biogenesis protein Urb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1568 Score = 31.5 bits (68), Expect = 0.084 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 5/46 (10%) Frame = -2 Query: 385 HISPTP-SIVLPFVSELIKKCQTMDF----VCIDLFR*HRATRQKK 263 H SPT VL F++ I +C + F VC+D F+ H QKK Sbjct: 555 HTSPTQHKAVLEFLNSCINRCISRVFAYLDVCVDCFKKHSVNSQKK 600 >SPBC6B1.09c |nbs1||Mre11 complex subunit Nbs1|Schizosaccharomyces pombe|chr 2|||Manual Length = 613 Score = 29.1 bits (62), Expect = 0.45 Identities = 18/68 (26%), Positives = 33/68 (48%), Gaps = 3/68 (4%) Frame = +2 Query: 287 SPKQINTDEVHRLTFFDQLRNERQDDRWSWGYVNS---NGSGQEKIKSTTTARTTNAVIY 457 SPK + L+ D ++ ++ + GY+++ NGS Q K + +T N++ Sbjct: 355 SPKSKRVKTLENLSIMDFVQPKQMFGKEPEGYLSNQSNNGSAQNKKSGDNSEKTKNSLKS 414 Query: 458 KSGDSSNT 481 S S+NT Sbjct: 415 SSKKSANT 422 >SPBC17F3.02 |nak1|orb3, mor4|PAK-related kinase Nak1|Schizosaccharomyces pombe|chr 2|||Manual Length = 652 Score = 28.3 bits (60), Expect = 0.78 Identities = 20/63 (31%), Positives = 27/63 (42%), Gaps = 1/63 (1%) Frame = +2 Query: 359 DDRWSWGYVNSNGSGQEKIKSTTTARTTNAVIYKSGDSSNTTEDVNPCSPFI-PPPARGF 535 DD W +G + S I T+T+ TT A S+ T V P S + PP+ Sbjct: 318 DDGWEFGTIKQGQSNVSSITGTSTSTTTAAT-----SSTTVTGTVIPKSSTVHEPPSSND 372 Query: 536 SAP 544 S P Sbjct: 373 SHP 375 >SPBC2G2.11 |||N-myristoyltransferase 1|Schizosaccharomyces pombe|chr 2|||Manual Length = 466 Score = 27.9 bits (59), Expect = 1.0 Identities = 21/80 (26%), Positives = 41/80 (51%), Gaps = 4/80 (5%) Frame = -2 Query: 469 ISTFIYYSVSCPGCCRAFNFFL----TRSVTVHISPTPSIVLPFVSELIKKCQTMDFVCI 302 IS F+ +++ PG + ++ + +R + IS P + + ++IKKC ++F+CI Sbjct: 129 ISEFLRWALMPPGYVKEWHVGVRVKSSRKLVAFISAVP-LSIRVRDKIIKKCAEVNFLCI 187 Query: 301 DLFR*HRATRQKKPSKNQIK 242 H+ R K+ + IK Sbjct: 188 -----HKKLRSKRLTPLLIK 202 >SPAC3H1.11 |hsr1||transcription factor Hsr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 582 Score = 25.4 bits (53), Expect = 5.5 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = +2 Query: 395 GSGQEKIKSTTTARTTNAVIYKSG---DSSNTTEDVNPCSPFIPPP 523 G+ Q S +T++ + V Y G +S+NTT+ +N + F PPP Sbjct: 103 GTSQYPSASFSTSQHPSQV-YNDGSTLNSNNTTQQLNNNNGFQPPP 147 >SPBC649.05 |cut12|stf1|spindle pole body protein Cut12 |Schizosaccharomyces pombe|chr 2|||Manual Length = 548 Score = 25.0 bits (52), Expect = 7.3 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = -3 Query: 381 YPQLHLSSCRSFRS*SKNVKRWTSSVLICFGDTVQHVKKNQVKIK 247 YP + F+ S N W+S + CF D V + +K + IK Sbjct: 181 YPHSMDAEISKFKWDSNNNNDWSSLMKDCFRDVVNNNRKMKEIIK 225 >SPAC19G12.15c |tpp1||trehalose-6-phosphate phosphatase Tpp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 817 Score = 25.0 bits (52), Expect = 7.3 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 Query: 281 TVSPKQINTDEVHRLTFFDQLRNERQDDRWSWG 379 TVS K+ N D V RL D R E +W+ G Sbjct: 96 TVSEKEENKDAVTRLDSQDVKRFEETYSQWNSG 128 >SPBC36.12c |git7||SGT1-like protein Git7|Schizosaccharomyces pombe|chr 2|||Manual Length = 379 Score = 25.0 bits (52), Expect = 7.3 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -3 Query: 357 CRSFRS*SKNVKRWTSSVLICFGDTVQHVKKNQV 256 C+S R + + S ICFG ++H+KK + Sbjct: 81 CQSLRGLAYYLLEQYQSSAICFGFALKHLKKEDL 114 >SPBC36.07 |iki3||RNA polymerase II elongator subunit Iki3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1253 Score = 24.6 bits (51), Expect = 9.6 Identities = 15/56 (26%), Positives = 27/56 (48%), Gaps = 4/56 (7%) Frame = +2 Query: 341 LRNERQDDRWSWGYVNSNGSGQEKIKSTTTARTTNAVIY----KSGDSSNTTEDVN 496 LR ++++D SW + I +T+ +TN +Y KS +SS T + + Sbjct: 1085 LREKKKEDPISWMEGTMEDQTPDDISLASTSLSTNRSLYTQYTKSSNSSKMTRNTS 1140 >SPAC2E12.02 |hsf1|hstf, hsf|transcription factor Hsf1|Schizosaccharomyces pombe|chr 1|||Manual Length = 609 Score = 24.6 bits (51), Expect = 9.6 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = +2 Query: 380 YVNSNGSGQEKIKSTTTARTTNAVIYKSGDSSNTTEDVN 496 Y++ N S + S TT+ + +GD N +D N Sbjct: 348 YISPNQSPNTDVPSLNRDDTTDPKVVNTGDIINMLDDAN 386 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,862,344 Number of Sequences: 5004 Number of extensions: 33384 Number of successful extensions: 100 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 100 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 225926624 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -