BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_M02 (573 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 24 1.1 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 21 7.5 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 21 7.5 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 21 7.5 AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 21 7.5 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 23.8 bits (49), Expect = 1.1 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -2 Query: 296 YLLSVYDEVSIYGLNGTLETTVSRIILEKVDHVVKTNER 180 YL+ Y + G+ T + +IL++V+HV K E+ Sbjct: 156 YLIFSYCPIVTTGIIKIQFATCAHLILQRVNHVKKILEK 194 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = +1 Query: 397 LLLTWWVEPRK*SSPHQVLML 459 +++T++ + + S PHQ+L L Sbjct: 114 IMITFYRDEPRFSQPHQILTL 134 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = +1 Query: 397 LLLTWWVEPRK*SSPHQVLML 459 +++T++ + + S PHQ+L L Sbjct: 274 IMITFYRDEPRFSQPHQILTL 294 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = +1 Query: 397 LLLTWWVEPRK*SSPHQVLML 459 +++T++ + + S PHQ+L L Sbjct: 274 IMITFYRDEPRFSQPHQILTL 294 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 198 YMVYLFQYDSTHG 236 ++V LFQY HG Sbjct: 378 FLVILFQYGGIHG 390 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,262 Number of Sequences: 336 Number of extensions: 3172 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14203976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -