BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_M01 (607 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 2.0 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 2.0 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 2.0 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 2.0 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 2.0 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 2.0 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 2.0 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 23 2.0 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 2.0 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 23 2.6 AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 23 2.6 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 22 4.6 DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 21 8.1 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +1 Query: 184 TRPTTSPANSSTIRISGITIDIRKRTT 264 T P ++P+NS+ + SG+T + T+ Sbjct: 126 TPPLSTPSNSNATKSSGLTSPLSVSTS 152 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +1 Query: 184 TRPTTSPANSSTIRISGITIDIRKRTT 264 T P ++P+NS+ + SG+T + T+ Sbjct: 126 TPPLSTPSNSNATKSSGLTSPLSVSTS 152 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +1 Query: 184 TRPTTSPANSSTIRISGITIDIRKRTT 264 T P ++P+NS+ + SG+T + T+ Sbjct: 126 TPPLSTPSNSNATKSSGLTSPLSVSTS 152 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +1 Query: 184 TRPTTSPANSSTIRISGITIDIRKRTT 264 T P ++P+NS+ + SG+T + T+ Sbjct: 126 TPPLSTPSNSNATKSSGLTSPLSVSTS 152 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +1 Query: 184 TRPTTSPANSSTIRISGITIDIRKRTT 264 T P ++P+NS+ + SG+T + T+ Sbjct: 126 TPPLSTPSNSNATKSSGLTSPLSVSTS 152 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +1 Query: 184 TRPTTSPANSSTIRISGITIDIRKRTT 264 T P ++P+NS+ + SG+T + T+ Sbjct: 82 TPPLSTPSNSNATKSSGLTSPLSVSTS 108 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +1 Query: 184 TRPTTSPANSSTIRISGITIDIRKRTT 264 T P ++P+NS+ + SG+T + T+ Sbjct: 126 TPPLSTPSNSNATKSSGLTSPLSVSTS 152 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +1 Query: 184 TRPTTSPANSSTIRISGITIDIRKRTT 264 T P ++P+NS+ + SG+T + T+ Sbjct: 126 TPPLSTPSNSNATKSSGLTSPLSVSTS 152 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +1 Query: 184 TRPTTSPANSSTIRISGITIDIRKRTT 264 T P ++P+NS+ + SG+T + T+ Sbjct: 126 TPPLSTPSNSNATKSSGLTSPLSVSTS 152 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 22.6 bits (46), Expect = 2.6 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 303 LETGNLPDLTEEQSSSIDESTRRDE 377 LET NL + + S +DES R E Sbjct: 503 LETNNLSETFTQNLSLMDESEGRQE 527 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 22.6 bits (46), Expect = 2.6 Identities = 8/32 (25%), Positives = 18/32 (56%) Frame = +3 Query: 186 TADDVARELIYDTNIRHNDRYPEANDVDNLDN 281 T+ + L+ ++ H + E +D+D++DN Sbjct: 254 TSSIMMHHLVNPQSLNHQEVKAECSDLDSVDN 285 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.8 bits (44), Expect = 4.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 261 DVDNLDNEIMEALTLETGNL 320 D D LDNE+ A L+ NL Sbjct: 600 DTDTLDNEMRGAWPLKLQNL 619 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 21.0 bits (42), Expect = 8.1 Identities = 10/38 (26%), Positives = 14/38 (36%) Frame = -1 Query: 535 KFQYLSTKCRCSQFSPDASHSDSKLCPSTPSWSKHSIR 422 K + C C Q S + S S CP + I+ Sbjct: 79 KIWQMERSCMCCQESGEREASVSLFCPKAKPGERKFIK 116 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,148 Number of Sequences: 336 Number of extensions: 2401 Number of successful extensions: 17 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15352827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -