BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_L23 (455 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 33 0.12 At2g23260.1 68415.m02778 UDP-glucoronosyl/UDP-glucosyl transfera... 30 0.85 At5g23720.2 68418.m02781 dual specificity protein phosphatase fa... 29 2.0 At5g23720.1 68418.m02780 dual specificity protein phosphatase fa... 29 2.0 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 28 2.6 At4g26750.1 68417.m03854 hydroxyproline-rich glycoprotein family... 28 2.6 At1g79480.1 68414.m09263 hypothetical protein low similarity to ... 28 3.4 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 27 6.0 At1g13290.1 68414.m01543 zinc finger (C2H2 type) family protein ... 27 6.0 At5g32590.1 68418.m03867 myosin heavy chain-related similar to M... 27 7.9 At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest ... 27 7.9 At3g42860.1 68416.m04491 zinc knuckle (CCHC-type) family protein... 27 7.9 At1g44446.2 68414.m05114 chlorophyll a oxygenase (CAO) / chlorop... 27 7.9 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 32.7 bits (71), Expect = 0.12 Identities = 20/68 (29%), Positives = 28/68 (41%), Gaps = 1/68 (1%) Frame = +1 Query: 100 PDYNPGQVPSDGN-SDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRY 276 P PG P + ++A P P+ P+ GP P+S+ PA N+P Y Sbjct: 227 PMMGPGAFPRGSQFTSGPMMAPPPPYGQPPNAGPFTGNSPLSSPPAHSIPPPTNFPGVPY 286 Query: 277 DNPLARGG 300 P GG Sbjct: 287 GRPPMPGG 294 >At2g23260.1 68415.m02778 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 456 Score = 29.9 bits (64), Expect = 0.85 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +2 Query: 5 SDTIRQ*KLSCFSSSPYWPWLPQTECTWSIITLII-IQA 118 S I + + SC SSP+ PW+P + +I I+ IQA Sbjct: 96 SKIIEEKRYSCIISSPFTPWVPAVAASHNISCAILWIQA 134 >At5g23720.2 68418.m02781 dual specificity protein phosphatase family protein contains Pfam profile: PF00782 dual specificity phosphatase, catalytic domain; contains TG acceptor splice site at intron 9 Length = 845 Score = 28.7 bits (61), Expect = 2.0 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 82 HVVDHNPDYNPGQVPSDGNSDH 147 H V+H P + +VPSD +SDH Sbjct: 470 HEVNHYPSPSKDRVPSDNSSDH 491 >At5g23720.1 68418.m02780 dual specificity protein phosphatase family protein contains Pfam profile: PF00782 dual specificity phosphatase, catalytic domain; contains TG acceptor splice site at intron 9 Length = 929 Score = 28.7 bits (61), Expect = 2.0 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 82 HVVDHNPDYNPGQVPSDGNSDH 147 H V+H P + +VPSD +SDH Sbjct: 554 HEVNHYPSPSKDRVPSDNSSDH 575 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 28.3 bits (60), Expect = 2.6 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +1 Query: 163 PDPFFSQPSNGPSG--NYEPISTGPAFVDFNHPNYPPKRYDNPLAR 294 P P S P N P ++ P + P+ +N P PP YD P R Sbjct: 357 PYPQQSYPPNPPRQPPSHPPPGSAPSQQYYNAPPTPPSMYDGPGGR 402 >At4g26750.1 68417.m03854 hydroxyproline-rich glycoprotein family protein Length = 421 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/44 (25%), Positives = 21/44 (47%) Frame = +1 Query: 100 PDYNPGQVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGP 231 P ++ +PS NP+P++S P + P+ + S+ P Sbjct: 296 PSFSESSLPSTSPHYPSHYQNPEPYYSSPHSAPAPSSTSFSSAP 339 Score = 27.5 bits (58), Expect = 4.5 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +1 Query: 184 PSNGPSGNYEPISTGPAFVDFNHP-NYPPKRYDNP 285 PS+ PS ++ P TGP+ + HP ++ P D P Sbjct: 236 PSSYPSNDHLPPPTGPSDSPYPHPYSHQPYHQDPP 270 >At1g79480.1 68414.m09263 hypothetical protein low similarity to beta-1,3-glucanase-like protein GI:9758115 from [Arabidopsis thaliana] Length = 356 Score = 27.9 bits (59), Expect = 3.4 Identities = 24/70 (34%), Positives = 31/70 (44%), Gaps = 3/70 (4%) Frame = +1 Query: 97 NPDYNPGQVPSDGN-SDHVVIANPDPFFSQPSNGP--SGNYEPISTGPAFVDFNHPNYPP 267 NP+ NP S N + V + NP S P N P S N P T P + + PN PP Sbjct: 146 NPNSNPNPPESSSNPNPPVTVPNPPESSSNP-NPPESSSNPNPPITIPYPPESSSPN-PP 203 Query: 268 KRYDNPLARG 297 + +P G Sbjct: 204 EIVPSPPESG 213 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 27.1 bits (57), Expect = 6.0 Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 5/71 (7%) Frame = +1 Query: 88 VDHNPDYNPGQ----VPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHP 255 V++ P Y+P +PS I+ P P FS P + P ++ P P + HP Sbjct: 5 VEYFPYYSPPSHQHPLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPP-SPYPHP 63 Query: 256 N-YPPKRYDNP 285 + PP Y +P Sbjct: 64 HPPPPSPYPHP 74 >At1g13290.1 68414.m01543 zinc finger (C2H2 type) family protein contains Pfam domian PF00096: Zinc finger, C2H2 type Length = 302 Score = 27.1 bits (57), Expect = 6.0 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +1 Query: 106 YNPGQVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAF-VDFNHP 255 YN Q G+ D VV++ P PS+ +P ST P+ +FNHP Sbjct: 2 YNNNQYSFSGDEDSVVLSLGPPGQQYPSHN-----KPTSTKPSSDHEFNHP 47 >At5g32590.1 68418.m03867 myosin heavy chain-related similar to Myosin heavy chain, non-muscle (Zipper protein) (Myosin II)(SP:Q99323) {Drosophila melanogaster} Length = 761 Score = 26.6 bits (56), Expect = 7.9 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Frame = +1 Query: 112 PGQVPSDGNSDHVVIANPDPFFS-----QPSNGPSGNYEPISTGP 231 P ++P NS+ VVI + D S QP+ G SG + ++ P Sbjct: 704 PPELPPSANSEKVVIEDDDGSDSGVPSEQPTTGESGENKTVAADP 748 >At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest subunit (RPB205) (RPII) (RPB1) nearly identical to P|P18616 DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6) {Arabidopsis thaliana} Length = 1840 Score = 26.6 bits (56), Expect = 7.9 Identities = 20/76 (26%), Positives = 28/76 (36%) Frame = +1 Query: 97 NPDYNPGQVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRY 276 +P Y+P +S ++P + P PS Y P T P + + Y P Sbjct: 1764 SPSYSPTSPSYSPSSPTYSPSSPYSSGASPDYSPSAGYSP--TLPGYSPSSTGQYTPHEG 1821 Query: 277 DNPLARGGK*MSHKDK 324 D G K S DK Sbjct: 1822 DKKDKTGKKDASKDDK 1837 >At3g42860.1 68416.m04491 zinc knuckle (CCHC-type) family protein contains Pfam domain, PF00098: Zinc knuckle Length = 372 Score = 26.6 bits (56), Expect = 7.9 Identities = 12/39 (30%), Positives = 17/39 (43%) Frame = +1 Query: 97 NPDYNPGQVPSDGNSDHVVIANPDPFFSQPSNGPSGNYE 213 NP Y PGQ+ S +S +S+ G S N + Sbjct: 289 NPKYEPGQMKSSSSSGECYKCGKQGHWSRDCTGQSSNQQ 327 >At1g44446.2 68414.m05114 chlorophyll a oxygenase (CAO) / chlorophyll b synthase identical to chlorophyll a oxygenase GI:5853117 from [Arabidopsis thaliana]; contains Pfam PF00355 Rieske [2Fe-2S] domain Length = 511 Score = 26.6 bits (56), Expect = 7.9 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -3 Query: 345 FLLVLKSLIFMRHLLPTTGERVVVSLGWIIGMIEIDERRSSAYGFIIS 202 F +LK+L FM HL E+V V WI + + +Y F IS Sbjct: 462 FAPILKNLPFMEHLWRHFAEQVKVHHKWIDHLQPSSQSCFLSYRFYIS 509 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,754,025 Number of Sequences: 28952 Number of extensions: 174952 Number of successful extensions: 505 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 504 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 752336160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -