BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= I09A02NGRL0001_L22
(603 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 23 7.6
>AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein.
Length = 1229
Score = 23.0 bits (47), Expect = 7.6
Identities = 11/41 (26%), Positives = 19/41 (46%)
Frame = -1
Query: 123 VFHNCCSELR*RHISSYLRLPRIQITKQKLGTSSQATGYFD 1
+F NCC+ + + Y +L R + + LG + Y D
Sbjct: 1069 LFTNCCNHISDAIDAIYKQLSRNEAAQAYLGPDNPEEPYLD 1109
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 628,068
Number of Sequences: 2352
Number of extensions: 12941
Number of successful extensions: 20
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 58450473
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -