BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_L20 (272 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5MGF9 Cluster: Putative uncharacterized protein; n=1; ... 76 2e-13 UniRef50_UPI00006CBD9F Cluster: MIF4G domain containing protein;... 38 0.058 UniRef50_Q5BBK2 Cluster: Putative uncharacterized protein; n=1; ... 35 0.41 UniRef50_A2ECL1 Cluster: Putative uncharacterized protein; n=1; ... 33 0.94 UniRef50_UPI0000F1DDC7 Cluster: PREDICTED: hypothetical protein;... 33 1.2 UniRef50_Q8SUL9 Cluster: Putative uncharacterized protein ECU08_... 33 1.2 UniRef50_Q9KQW8 Cluster: Rec2-related protein; n=18; Vibrio chol... 33 1.6 UniRef50_Q5KGK4 Cluster: Putative uncharacterized protein; n=1; ... 32 2.2 UniRef50_Q9VZG4 Cluster: CG15005-PA; n=2; Sophophora|Rep: CG1500... 32 2.9 UniRef50_UPI000155BFF2 Cluster: PREDICTED: hypothetical protein,... 31 3.8 UniRef50_A6DLC2 Cluster: Putative uncharacterized protein; n=1; ... 31 3.8 UniRef50_UPI000023ED9B Cluster: hypothetical protein FG07934.1; ... 31 6.6 UniRef50_Q0GLC9 Cluster: Dof22; n=1; Glycine max|Rep: Dof22 - Gl... 31 6.6 UniRef50_UPI00006CF1E9 Cluster: RNA polymerase Rpb1, domain 2 fa... 30 8.7 UniRef50_UPI00004995CF Cluster: hypothetical protein 78.t00032; ... 30 8.7 UniRef50_A5UUY4 Cluster: Peptidase S9, prolyl oligopeptidase act... 30 8.7 UniRef50_Q6C419 Cluster: Similar to wi|NCU08967.1 Neurospora cra... 30 8.7 UniRef50_A2QMM8 Cluster: Contig An07c0070, complete genome; n=2;... 30 8.7 UniRef50_Q09868 Cluster: RNA-binding post-transcriptional regula... 30 8.7 >UniRef50_Q5MGF9 Cluster: Putative uncharacterized protein; n=1; Lonomia obliqua|Rep: Putative uncharacterized protein - Lonomia obliqua (Moth) Length = 88 Score = 75.8 bits (178), Expect = 2e-13 Identities = 38/64 (59%), Positives = 44/64 (68%), Gaps = 1/64 (1%) Frame = +1 Query: 79 VHVVDNSG-VPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKR 255 V VVDNS VPSDG VI+NPDPFFSQPSNGP+G Y+ PAFVD ++ P K Sbjct: 22 VQVVDNSNQVPSDGQ---FVISNPDPFFSQPSNGPNGGYQQPDISPAFVDNSNQYRPQKH 78 Query: 256 YDNP 267 YD+P Sbjct: 79 YDHP 82 >UniRef50_UPI00006CBD9F Cluster: MIF4G domain containing protein; n=1; Tetrahymena thermophila SB210|Rep: MIF4G domain containing protein - Tetrahymena thermophila SB210 Length = 1058 Score = 37.5 bits (83), Expect = 0.058 Identities = 19/62 (30%), Positives = 31/62 (50%) Frame = +1 Query: 82 HVVDNSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYD 261 +V+ N+G P + N+ + AN P P N +GN + P F+ HPN+P + + Sbjct: 62 NVIINNGTPYNNNNMDINNANR-PANLYPLNLNNGNIQQFQQTPPFIQTQHPNFPNQPFI 120 Query: 262 NP 267 P Sbjct: 121 QP 122 >UniRef50_Q5BBK2 Cluster: Putative uncharacterized protein; n=1; Emericella nidulans|Rep: Putative uncharacterized protein - Emericella nidulans (Aspergillus nidulans) Length = 1458 Score = 34.7 bits (76), Expect = 0.41 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +1 Query: 148 DPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYP 246 D F QPSNG GN E I P F++ N P+ P Sbjct: 527 DQNFDQPSNG--GNMEDIQESPGFIESNKPDVP 557 >UniRef50_A2ECL1 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 713 Score = 33.5 bits (73), Expect = 0.94 Identities = 15/59 (25%), Positives = 32/59 (54%) Frame = +1 Query: 73 NRVHVVDNSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPP 249 N+ ++ + + + G + ++ NP + + GP+ + P ++GP ++ N PNYPP Sbjct: 286 NQNYIPPPNSMQNSGPNYNMGPNNPQNQYPNNNRGPNPIFNP-NSGPGYMQRNPPNYPP 343 >UniRef50_UPI0000F1DDC7 Cluster: PREDICTED: hypothetical protein; n=1; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 735 Score = 33.1 bits (72), Expect = 1.2 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 124 HYCRPMEHHYCPPRELCLRQP 62 H CR + HHY PR CLR P Sbjct: 324 HNCRSVGHHYATPRRSCLRCP 344 >UniRef50_Q8SUL9 Cluster: Putative uncharacterized protein ECU08_1490; n=1; Encephalitozoon cuniculi|Rep: Putative uncharacterized protein ECU08_1490 - Encephalitozoon cuniculi Length = 389 Score = 33.1 bits (72), Expect = 1.2 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +1 Query: 91 DNSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAF 219 D+SG SD +S+ PF+ G G Y P +TG F Sbjct: 187 DSSGYDSDTSSEDYYRRGRKPFYDSDGRGGPGGYGPFNTGMGF 229 >UniRef50_Q9KQW8 Cluster: Rec2-related protein; n=18; Vibrio cholerae|Rep: Rec2-related protein - Vibrio cholerae Length = 752 Score = 32.7 bits (71), Expect = 1.6 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 44 SSPYWPWLPQTEFTWWTIVV 103 S+PYWPW+P + W ++V Sbjct: 24 SAPYWPWMPSWGWAWLCLIV 43 >UniRef50_Q5KGK4 Cluster: Putative uncharacterized protein; n=1; Filobasidiella neoformans|Rep: Putative uncharacterized protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 375 Score = 32.3 bits (70), Expect = 2.2 Identities = 17/54 (31%), Positives = 31/54 (57%) Frame = +1 Query: 103 VPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDN 264 +P+ G + + ++P P ++ PS SG+ +++GP+ VDF+ P P R N Sbjct: 81 IPAQGLPEDQIPSDPPPAYT-PSANMSGS-TTVASGPSHVDFSGPPPMPDRIAN 132 >UniRef50_Q9VZG4 Cluster: CG15005-PA; n=2; Sophophora|Rep: CG15005-PA - Drosophila melanogaster (Fruit fly) Length = 750 Score = 31.9 bits (69), Expect = 2.9 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 142 NPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDNP 267 +P P +SQP PS +Y+ + P+ P +P Y+ P Sbjct: 339 HPPPSYSQPPQHPSSSYDQPAQHPSSSYDQPPKHPSSSYEQP 380 >UniRef50_UPI000155BFF2 Cluster: PREDICTED: hypothetical protein, partial; n=2; Mammalia|Rep: PREDICTED: hypothetical protein, partial - Ornithorhynchus anatinus Length = 886 Score = 31.5 bits (68), Expect = 3.8 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = +1 Query: 94 NSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPP 249 +S PS G+S + P F PS+ + P+S P +D P PP Sbjct: 736 SSKTPSPGSSSPSAPPSGKPSFGTPSSSRANGSRPLSPAPPALDRPRPPNPP 787 >UniRef50_A6DLC2 Cluster: Putative uncharacterized protein; n=1; Lentisphaera araneosa HTCC2155|Rep: Putative uncharacterized protein - Lentisphaera araneosa HTCC2155 Length = 161 Score = 31.5 bits (68), Expect = 3.8 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +1 Query: 97 SGVPSDGNSDHVVIA-NPDPFFSQPSNGPSGNYEPISTG 210 +G+ S SD ++ + +PD F SQ N P G P S G Sbjct: 53 AGIYSQEQSDKLIFSTSPDSFSSQEENSPEGGEAPASDG 91 >UniRef50_UPI000023ED9B Cluster: hypothetical protein FG07934.1; n=1; Gibberella zeae PH-1|Rep: hypothetical protein FG07934.1 - Gibberella zeae PH-1 Length = 1389 Score = 30.7 bits (66), Expect = 6.6 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +1 Query: 94 NSGVPSDGNSDHVVIANPDPFFSQPSNGPSG 186 NSG SD N + +NPD F P++GP+G Sbjct: 343 NSGNGSDSNGEGDSHSNPDSPFFPPTSGPTG 373 >UniRef50_Q0GLC9 Cluster: Dof22; n=1; Glycine max|Rep: Dof22 - Glycine max (Soybean) Length = 341 Score = 30.7 bits (66), Expect = 6.6 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +1 Query: 82 HVVDNSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNH 234 + V N+ + D N + V ANP+P+ Q +G G + I + + V+ N+ Sbjct: 164 NAVSNNNLLLDNNRESKVFANPNPYLEQSRSG--GLFSDIESFSSLVNLNN 212 >UniRef50_UPI00006CF1E9 Cluster: RNA polymerase Rpb1, domain 2 family protein; n=1; Tetrahymena thermophila SB210|Rep: RNA polymerase Rpb1, domain 2 family protein - Tetrahymena thermophila SB210 Length = 1759 Score = 30.3 bits (65), Expect = 8.7 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = +1 Query: 94 NSGVPSDGNSDHVVIANPDPFFSQP---SNGPSGNYEPISTGPAFVDFNHPNY 243 N PS + AN P+ S P S+ SG + P T P+ V +N P+Y Sbjct: 1641 NYSPPSHTPAGSTSPANASPYASSPQYKSSSLSGAHSPSYTSPSQVRYNSPSY 1693 >UniRef50_UPI00004995CF Cluster: hypothetical protein 78.t00032; n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical protein 78.t00032 - Entamoeba histolytica HM-1:IMSS Length = 675 Score = 30.3 bits (65), Expect = 8.7 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +1 Query: 73 NRVHVVDNSGVPSDGNSDHVVIANPDPFFSQPSNGPS 183 N H V S P+ NS H+ +A PD S P N P+ Sbjct: 49 NYNHCVGYSNSPTRLNSPHITLALPDSVPSSPHNTPA 85 >UniRef50_A5UUY4 Cluster: Peptidase S9, prolyl oligopeptidase active site domain protein; n=7; Bacteria|Rep: Peptidase S9, prolyl oligopeptidase active site domain protein - Roseiflexus sp. RS-1 Length = 644 Score = 30.3 bits (65), Expect = 8.7 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +1 Query: 103 VPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYP 246 VP DG + V+ F++ P P G T A++ +NHPN P Sbjct: 153 VPLDGTTGQQVLVAGSDFYAHPRLSPDG------TWLAWLSWNHPNMP 194 >UniRef50_Q6C419 Cluster: Similar to wi|NCU08967.1 Neurospora crassa NCU08967.1 predicted protein; n=1; Yarrowia lipolytica|Rep: Similar to wi|NCU08967.1 Neurospora crassa NCU08967.1 predicted protein - Yarrowia lipolytica (Candida lipolytica) Length = 482 Score = 30.3 bits (65), Expect = 8.7 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Frame = +1 Query: 109 SDGNSDHVVIANPDPFFSQPSNGPSGNY---EPISTGPAFVDFNHPNYPPKRYDNP 267 +DG + + + P +S S G S NY +P S PA V P YPP++ P Sbjct: 225 NDGPVEVIELRKPQDIWSGISAG-SRNYKGRQPTSPNPAAVTAPPPGYPPEKSGGP 279 >UniRef50_A2QMM8 Cluster: Contig An07c0070, complete genome; n=2; Aspergillus niger|Rep: Contig An07c0070, complete genome - Aspergillus niger Length = 1080 Score = 30.3 bits (65), Expect = 8.7 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = +1 Query: 103 VPSDGNSDHVVIANPDPFFSQP----SNGPSGNYEPISTGPAFVDFNHPNYPP 249 +PS G + A P P +P S PS NY ++T + + + P+ PP Sbjct: 38 LPSKGKKEEAKSATPKPASPKPAKEKSRAPSTNYTTLATRVSLMTTSPPSIPP 90 >UniRef50_Q09868 Cluster: RNA-binding post-transcriptional regulator cip2; n=2; Schizosaccharomyces pombe|Rep: RNA-binding post-transcriptional regulator cip2 - Schizosaccharomyces pombe (Fission yeast) Length = 576 Score = 30.3 bits (65), Expect = 8.7 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 94 NSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPI 201 N V DG + VVI P F+ P+N S N+ P+ Sbjct: 402 NHSVTGDGEAKQVVITMPSTHFT-PANNSSANHSPL 436 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 282,230,634 Number of Sequences: 1657284 Number of extensions: 5340247 Number of successful extensions: 15037 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 14522 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15016 length of database: 575,637,011 effective HSP length: 68 effective length of database: 462,941,699 effective search space used: 10184717378 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -