BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_L19 (466 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 26 0.75 AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant r... 24 3.0 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 23 4.0 CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine... 22 9.2 AY748834-1|AAV28182.1| 171|Anopheles gambiae cytochrome P450 pr... 22 9.2 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 22 9.2 AF510715-1|AAP47144.1| 470|Anopheles gambiae Rh-like glycoprote... 22 9.2 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 25.8 bits (54), Expect = 0.75 Identities = 13/59 (22%), Positives = 28/59 (47%) Frame = +3 Query: 156 WPPNQRQREDCEVINFKKLNSQEVYQAGNNCYRLNLSSEQSIVMGTYKNSTGKIVNLLY 332 W + ++CE + ++L++Q + CY L S T + + +++NL+Y Sbjct: 151 WKETHQLIQECEQDHVQRLSNQRSHYKRIQCYSLKQRSLVDAFQKTIRKAE-EVLNLVY 208 >AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant receptor Or5 protein. Length = 391 Score = 23.8 bits (49), Expect = 3.0 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 259 ICHPSNRLLWVHTRIVLGKLSIY 327 + H L W HTR+ L SI+ Sbjct: 165 VLHLEEELYWFHTRVSLVDYSIF 187 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 23.4 bits (48), Expect = 4.0 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +2 Query: 248 LSSKFVIRAIDCYGYIQE*YWENCQFTLLW*R 343 L K V R + CY Y+ + EN L W R Sbjct: 1059 LRHKLVERFLPCYRYLPDPVQENDCIKLYWDR 1090 >CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine-phosphate lyase protein. Length = 519 Score = 22.2 bits (45), Expect = 9.2 Identities = 15/26 (57%), Positives = 17/26 (65%), Gaps = 4/26 (15%) Frame = -2 Query: 390 TSI*FD-HKTG---KGSSLLLYHNKV 325 TSI D HK G KGSS++LY KV Sbjct: 304 TSISADTHKYGFTPKGSSVILYSEKV 329 >AY748834-1|AAV28182.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 22.2 bits (45), Expect = 9.2 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +1 Query: 262 CHPSNRLLWVHTRIVLGKLSIYFIMVKEK*RAF 360 C S R + +HT L L +++KE R F Sbjct: 20 CELSLRAICLHTLSALNNLHYMELVIKESLRLF 52 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 22.2 bits (45), Expect = 9.2 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +1 Query: 124 DSWEQRMPFIFGHRIKGKGRTVK*LTSRN*TLKR 225 D W PF R+ +G+ TSRN L+R Sbjct: 1379 DRWLTGSPFFCSVRLIAEGQKRTLATSRNFLLRR 1412 >AF510715-1|AAP47144.1| 470|Anopheles gambiae Rh-like glycoprotein protein. Length = 470 Score = 22.2 bits (45), Expect = 9.2 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +3 Query: 114 DLNGLLGTTYAVYFWP 161 D++ ++GT + FWP Sbjct: 217 DISAMIGTIFLWIFWP 232 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 480,554 Number of Sequences: 2352 Number of extensions: 9173 Number of successful extensions: 21 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 40395045 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -