BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_L14 (467 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methy... 25 1.3 EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. 25 1.7 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 25 1.7 M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 23 4.0 AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. 23 7.0 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 22 9.3 >AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methylase protein. Length = 459 Score = 25.0 bits (52), Expect = 1.3 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 Query: 247 RFQSSQLSTQAIRQPSRPWWEVNVS*R*AILKLGEMMINL 366 R + Q+ T A P RP+W V + A KL ++L Sbjct: 29 RIWNIQMETPADHNPERPFWVVGLQNDEAARKLASRSMSL 68 >EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. Length = 399 Score = 24.6 bits (51), Expect = 1.7 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 10 VLIRQTTLTLFDNESFRVFLLRRIGHGCRKQSS 108 VL R TLFD E F VF + G KQS+ Sbjct: 311 VLKRMGHETLFDREGFAVFRDHKSMLGALKQST 343 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 24.6 bits (51), Expect = 1.7 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = -2 Query: 124 TIVHHVNSVCGSHGQYGEEEKHESFHCRIVSEL 26 +I H + +CG + +EK E+F ++ L Sbjct: 2732 SISHGLEQICGGSADFPSQEKAENFLMHLLMPL 2764 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 23.4 bits (48), Expect = 4.0 Identities = 10/37 (27%), Positives = 16/37 (43%) Frame = +2 Query: 164 ANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPP 274 A+PD F S P + +S ++ P +PP Sbjct: 370 AHPDHFLDHRSPSPQRGNQSLSQMTEILEAIQPEFPP 406 >AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. Length = 189 Score = 22.6 bits (46), Expect = 7.0 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +1 Query: 286 QPSRPWWEV 312 +P RPWW V Sbjct: 78 RPGRPWWSV 86 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 22.2 bits (45), Expect = 9.3 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 262 GMIEIDERRSSAYGFII 212 G+++ DER +SAY F + Sbjct: 680 GLMDCDERFTSAYQFAV 696 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 439,697 Number of Sequences: 2352 Number of extensions: 9389 Number of successful extensions: 42 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 40820256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -