BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_L12 (593 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF065522-1|ABK59322.1| 255|Anopheles gambiae beta carbonic anhy... 26 1.1 AY994089-1|AAX86002.1| 267|Anopheles gambiae hyp37.7-like precu... 24 3.2 CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein... 23 7.4 EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 23 9.8 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 9.8 AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 23 9.8 >EF065522-1|ABK59322.1| 255|Anopheles gambiae beta carbonic anhydrase protein. Length = 255 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 308 IFPENNFANEEQLKQIESV 364 I PENNFA E++L Q+ ++ Sbjct: 172 IDPENNFAIEDKLSQVNTL 190 >AY994089-1|AAX86002.1| 267|Anopheles gambiae hyp37.7-like precursor protein. Length = 267 Score = 24.2 bits (50), Expect = 3.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 485 EEHSHAGPGVQCAH 526 ++HS AGPG AH Sbjct: 88 DKHSQAGPGTHAAH 101 >CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein protein. Length = 415 Score = 23.0 bits (47), Expect = 7.4 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +2 Query: 362 VLPPRPAFVMPTGDDVEEVNLMEFTASERGRGREEAYASDDEE 490 V P P ++ TG++V EVN + E G E+ ++ + Sbjct: 116 VYEPPPVVLIDTGNNVVEVNTDDQIVLEDGSVEGESNEQEEAQ 158 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 22.6 bits (46), Expect = 9.8 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +1 Query: 355 RECFTTSPCVCDANW 399 REC T P +C +W Sbjct: 52 RECDNTQPRICHFSW 66 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 22.6 bits (46), Expect = 9.8 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +2 Query: 257 QYKNPFEKGNLYIK 298 Q +NP+ KG LY++ Sbjct: 1613 QLQNPWRKGRLYVR 1626 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 22.6 bits (46), Expect = 9.8 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 368 PPRPAFVMPTGDD 406 PP PA +P GDD Sbjct: 425 PPLPALPLPGGDD 437 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 620,733 Number of Sequences: 2352 Number of extensions: 12145 Number of successful extensions: 38 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57188952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -