BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_L09 (390 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 246 7e-68 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 246 7e-68 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 126 9e-32 EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 93 8e-22 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 28 0.033 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 24 0.54 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 22 2.2 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 22 2.9 DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 21 5.0 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 21 5.0 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 21 5.0 DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 21 6.6 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 6.6 AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 21 6.6 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 20 8.7 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 20 8.7 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 20 8.7 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 20 8.7 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 20 8.7 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 20 8.7 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 20 8.7 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 20 8.7 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 20 8.7 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 20 8.7 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 20 8.7 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 20 8.7 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 20 8.7 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 20 8.7 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 20 8.7 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 20 8.7 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 20 8.7 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 20 8.7 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 20 8.7 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 246 bits (602), Expect = 7e-68 Identities = 114/116 (98%), Positives = 115/116 (99%) Frame = +1 Query: 43 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 222 MGKEK+HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL Sbjct: 1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60 Query: 223 DKLKAERERGITIDIALWKFETGKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 390 DKLKAERERGITIDIALWKFET KYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV Sbjct: 61 DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 246 bits (602), Expect = 7e-68 Identities = 114/116 (98%), Positives = 115/116 (99%) Frame = +1 Query: 43 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 222 MGKEK+HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL Sbjct: 1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60 Query: 223 DKLKAERERGITIDIALWKFETGKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 390 DKLKAERERGITIDIALWKFET KYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV Sbjct: 61 DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 126 bits (304), Expect = 9e-32 Identities = 58/59 (98%), Positives = 58/59 (98%) Frame = +1 Query: 214 WVLDKLKAERERGITIDIALWKFETGKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 390 WVLDKLKAERERGITIDIALWKFET KYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV Sbjct: 1 WVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 59 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 93.5 bits (222), Expect = 8e-22 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = +1 Query: 262 DIALWKFETGKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 390 DIALWKFET KYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV Sbjct: 1 DIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 43 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 28.3 bits (60), Expect = 0.033 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +1 Query: 301 VTIIDAPGHRDFIKNMITGTSQADCAVLIV 390 VT +D PGH FI G D VL+V Sbjct: 195 VTFLDTPGHAAFISMRHRGAHITDIVVLVV 224 Score = 24.6 bits (51), Expect = 0.41 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 55 KVHINIVVIGHVDSGKST 108 K H + ++GHVD GK+T Sbjct: 143 KRHPIVTIMGHVDHGKTT 160 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 24.2 bits (50), Expect = 0.54 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +1 Query: 64 INIVVIGHVDSGKST 108 INI IGHV GKST Sbjct: 43 INIGTIGHVAHGKST 57 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 22.2 bits (45), Expect = 2.2 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +1 Query: 286 TGKYYVTIIDAPGHRDFIKNMITGTSQADCAVLI 387 T KYY D P + FIKN+ ++ +D LI Sbjct: 294 TMKYYDYGADFPFNFAFIKNVSRDSNSSDFKKLI 327 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 2.9 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 286 TGKYYVTIIDAPGHRDFIKNMITGTSQADCAVLI 387 T KYY D P + FIKN+ ++ +D L+ Sbjct: 294 TMKYYDYGADFPFNFAFIKNVSRDSNSSDFKKLV 327 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 21.0 bits (42), Expect = 5.0 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +1 Query: 145 DKRTIEKFEKEAQEMG 192 DK+ KFE+EA+++G Sbjct: 112 DKKYRVKFEEEAKKLG 127 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 21.0 bits (42), Expect = 5.0 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +1 Query: 145 DKRTIEKFEKEAQEMG 192 DK+ KFE+EA+++G Sbjct: 112 DKKFRVKFEEEAKKLG 127 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 21.0 bits (42), Expect = 5.0 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +1 Query: 145 DKRTIEKFEKEAQEMG 192 DK+ KFE+EA+++G Sbjct: 112 DKKYRVKFEEEAKKLG 127 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 20.6 bits (41), Expect = 6.6 Identities = 5/11 (45%), Positives = 9/11 (81%) Frame = -3 Query: 160 RWYVCRYHRIC 128 RW + ++HR+C Sbjct: 186 RWDLGKFHRVC 196 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 20.6 bits (41), Expect = 6.6 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 128 TNAVVSTNVPSKSSRRKPRKWVRVPSNTLGYWTN 229 TNA + S+S R+ ++ RVPS G T+ Sbjct: 1767 TNASAHSRSGSQSMPRQNGRYSRVPSQGGGSGTH 1800 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 20.6 bits (41), Expect = 6.6 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 219 YPSVFEGTLTHFLG 178 YPS+ +GT ++ LG Sbjct: 25 YPSIRQGTTSYCLG 38 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 20.2 bits (40), Expect = 8.7 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = +3 Query: 273 LEVRNRQILCHHHRRSWTQRFHQEHDH 353 L R ++ H R +W + +E +H Sbjct: 27 LRSRTKEERLQHRREAWLIQQEREREH 53 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 20.2 bits (40), Expect = 8.7 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = +3 Query: 273 LEVRNRQILCHHHRRSWTQRFHQEHDH 353 L R ++ H R +W + +E +H Sbjct: 27 LRSRTKEERLQHRREAWLIQQEREREH 53 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 20.2 bits (40), Expect = 8.7 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = +3 Query: 273 LEVRNRQILCHHHRRSWTQRFHQEHDH 353 L R ++ H R +W + +E +H Sbjct: 27 LRSRTKEERLQHRREAWLIQQEREREH 53 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.2 bits (40), Expect = 8.7 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = +3 Query: 273 LEVRNRQILCHHHRRSWTQRFHQEHDH 353 L R ++ H R +W + +E +H Sbjct: 27 LRSRTKEERLQHRREAWLIQQEREREH 53 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.2 bits (40), Expect = 8.7 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = +3 Query: 273 LEVRNRQILCHHHRRSWTQRFHQEHDH 353 L R ++ H R +W + +E +H Sbjct: 27 LRSRTKEERLQHRREAWLIQQEREREH 53 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.2 bits (40), Expect = 8.7 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = +3 Query: 273 LEVRNRQILCHHHRRSWTQRFHQEHDH 353 L R ++ H R +W + +E +H Sbjct: 27 LRSRTKEERLQHRREAWLIQQEREREH 53 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.2 bits (40), Expect = 8.7 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = +3 Query: 273 LEVRNRQILCHHHRRSWTQRFHQEHDH 353 L R ++ H R +W + +E +H Sbjct: 27 LRSRTKEERLQHRREAWLIQQEREREH 53 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 20.2 bits (40), Expect = 8.7 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = +3 Query: 273 LEVRNRQILCHHHRRSWTQRFHQEHDH 353 L R ++ H R +W + +E +H Sbjct: 27 LRSRTKEERLQHRREAWLIQQEREREH 53 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 20.2 bits (40), Expect = 8.7 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = +3 Query: 273 LEVRNRQILCHHHRRSWTQRFHQEHDH 353 L R ++ H R +W + +E +H Sbjct: 27 LRSRTKEERLQHRREAWLIQQEREREH 53 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 20.2 bits (40), Expect = 8.7 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = +3 Query: 273 LEVRNRQILCHHHRRSWTQRFHQEHDH 353 L R ++ H R +W + +E +H Sbjct: 27 LRSRTKEERLQHRREAWLIQQEREREH 53 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 20.2 bits (40), Expect = 8.7 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = +3 Query: 273 LEVRNRQILCHHHRRSWTQRFHQEHDH 353 L R ++ H R +W + +E +H Sbjct: 27 LRSRTKEERLQHRREAWLIQQEREREH 53 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 20.2 bits (40), Expect = 8.7 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = +3 Query: 273 LEVRNRQILCHHHRRSWTQRFHQEHDH 353 L R ++ H R +W + +E +H Sbjct: 27 LRSRTKEERLQHRREAWLIQQEREREH 53 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 20.2 bits (40), Expect = 8.7 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = +3 Query: 273 LEVRNRQILCHHHRRSWTQRFHQEHDH 353 L R ++ H R +W + +E +H Sbjct: 27 LRSRTKEERLQHRREAWLIQQEREREH 53 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 20.2 bits (40), Expect = 8.7 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = +3 Query: 273 LEVRNRQILCHHHRRSWTQRFHQEHDH 353 L R ++ H R +W + +E +H Sbjct: 27 LRSRTKEERLQHRREAWLIQQEREREH 53 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 20.2 bits (40), Expect = 8.7 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = +3 Query: 273 LEVRNRQILCHHHRRSWTQRFHQEHDH 353 L R ++ H R +W + +E +H Sbjct: 27 LRSRTKEERLQHRREAWLIQQEREREH 53 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 20.2 bits (40), Expect = 8.7 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = +3 Query: 273 LEVRNRQILCHHHRRSWTQRFHQEHDH 353 L R ++ H R +W + +E +H Sbjct: 27 LRSRTKEERLQHRREAWLIQQEREREH 53 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 20.2 bits (40), Expect = 8.7 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = +3 Query: 273 LEVRNRQILCHHHRRSWTQRFHQEHDH 353 L R ++ H R +W + +E +H Sbjct: 27 LRSRTKEERLQHRREAWLIQQEREREH 53 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 20.2 bits (40), Expect = 8.7 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +3 Query: 303 HHHRRSWTQ 329 HH +SWTQ Sbjct: 405 HHGSKSWTQ 413 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 20.2 bits (40), Expect = 8.7 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -1 Query: 309 DGDIVFAGFELPESNIDGDTT 247 DG I A F + + I GD T Sbjct: 121 DGHIKIADFGMCKEGISGDKT 141 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,272 Number of Sequences: 438 Number of extensions: 2303 Number of successful extensions: 34 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9514659 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -