BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_L05 (647 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79720.1 68414.m09298 aspartyl protease family protein contai... 29 3.5 >At1g79720.1 68414.m09298 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 484 Score = 28.7 bits (61), Expect = 3.5 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +2 Query: 35 VKMKVAPVLFVVLLSLMCVVQCKDLIVGTSFNNRLIWQEKADYNA 169 + + +AP+L V L L CVV D S +N IW K Y A Sbjct: 7 LNLSLAPLLLVFLFLLSCVVHGVDEKKILSVHNN-IWSPKKSYEA 50 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,995,221 Number of Sequences: 28952 Number of extensions: 230723 Number of successful extensions: 466 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 466 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1344285648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -