BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_L04 (369 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like pr... 21 5.3 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 20 9.2 >AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like protein protein. Length = 242 Score = 20.6 bits (41), Expect = 5.3 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +3 Query: 51 DADEDHRITLAEWGKCLQLDEYELEDRCDEFIDDL*HGAL 170 D D RI GK L D+ +DR D+ + + H L Sbjct: 180 DTDMHGRIKSERNGKDLDDDDMNDDDRKDDLLGNNMHHIL 219 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 19.8 bits (39), Expect = 9.2 Identities = 6/18 (33%), Positives = 11/18 (61%) Frame = +2 Query: 263 ILSIFTVCSNLWQMSSNS 316 I + ++C +WQ S +S Sbjct: 220 IFTYTSICIEIWQSSESS 237 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 71,918 Number of Sequences: 336 Number of extensions: 1328 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 7616520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -