BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_L04 (369 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 22 2.6 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 4.6 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 21 6.1 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 20 8.1 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 20 8.1 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 21.8 bits (44), Expect = 2.6 Identities = 9/36 (25%), Positives = 20/36 (55%) Frame = -1 Query: 303 ICHRFEQTVKIDKIFFLLNSKSKLQSHVIKSEWRYV 196 + E+T+ D F ++K+K + ++ +W+YV Sbjct: 508 LVREIEKTID-DARFIAQHAKNKDKFESVEEDWKYV 542 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.0 bits (42), Expect = 4.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 39 LDQCDADEDHRITLAEWGKC 98 LD D+D I +A++G C Sbjct: 113 LDNVLLDQDGHIKIADFGMC 132 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 20.6 bits (41), Expect = 6.1 Identities = 6/21 (28%), Positives = 14/21 (66%) Frame = +3 Query: 291 ICGKCLQIVKLFFTISHTFNF 353 +CG + + L++ ++ TF+F Sbjct: 8 LCGIAVLFLALYYYLTSTFDF 28 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 20.2 bits (40), Expect = 8.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 105 LDEYELEDRCDEFIDDL*HGAL 170 LD Y ++ +EF+ L HG L Sbjct: 68 LDNYNDKEAVNEFMQLLKHGML 89 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 20.2 bits (40), Expect = 8.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 105 LDEYELEDRCDEFIDDL*HGAL 170 LD Y ++ +EF+ L HG L Sbjct: 68 LDNYNDKEAVNEFMQLLKHGML 89 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,424 Number of Sequences: 438 Number of extensions: 1440 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8804355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -