BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_K24 (605 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC13G1.07 |||palmitoyltransferase|Schizosaccharomyces pombe|ch... 30 0.30 SPBC13A2.03 |||phosphatidate cytidylyltransferase|Schizosaccharo... 27 2.8 >SPBC13G1.07 |||palmitoyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 356 Score = 29.9 bits (64), Expect = 0.30 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +2 Query: 440 FKYKVF--SKSSLCSF*STYI*RHCFYCNLCV 529 + YK+F +K S C F +HC CN+CV Sbjct: 150 YDYKIFFPNKCSTCKFEKPARSKHCRLCNICV 181 >SPBC13A2.03 |||phosphatidate cytidylyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 439 Score = 26.6 bits (56), Expect = 2.8 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = +1 Query: 88 YMMYEFLMF*FILH--FYNFILYCRFFFLNETSFKLCYVNFKFKKVSLNHMQKLLSV 252 ++M F M +LH F +F+LY F L S K F+F + HM LL V Sbjct: 136 FIMDSF-MLPLVLHHRFISFMLYIIGFVLFVASLKKGNYKFQFSQFCWTHMTLLLVV 191 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,964,445 Number of Sequences: 5004 Number of extensions: 33794 Number of successful extensions: 65 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 266270664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -