BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_K21 (538 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7YY85 Cluster: Cytohesin-like protein, possible; n=5; ... 33 3.1 UniRef50_A2EKC4 Cluster: Putative uncharacterized protein; n=1; ... 33 5.5 UniRef50_UPI00006CBA23 Cluster: hypothetical protein TTHERM_0055... 32 7.3 UniRef50_Q8IBX7 Cluster: Putative uncharacterized protein MAL7P1... 32 7.3 UniRef50_Q5AB73 Cluster: Putative uncharacterized protein; n=1; ... 32 9.6 >UniRef50_Q7YY85 Cluster: Cytohesin-like protein, possible; n=5; Cryptosporidium|Rep: Cytohesin-like protein, possible - Cryptosporidium parvum Length = 1785 Score = 33.5 bits (73), Expect = 3.1 Identities = 16/48 (33%), Positives = 27/48 (56%) Frame = -1 Query: 253 FSNLL*PMDYFTLLLLTEQVLPTRLPFLRRYYFNLLSSLSFHIDLISI 110 F+NLL + + +L + + RL F + L+ SL++H DL+SI Sbjct: 1131 FTNLLHNSFFLDMFMLNHRNVKMRLDFFDMLFKELMPSLAYHFDLLSI 1178 >UniRef50_A2EKC4 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 445 Score = 32.7 bits (71), Expect = 5.5 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = -1 Query: 172 LRRYYFNLLSSLSFH--IDLISILISIMHIDMYRRLKLDDVHFTYN 41 L+ Y + L S+ FH ID + + S+ + D +RLKL+D HF N Sbjct: 144 LKFYEDDTLQSIIFHDDIDKLVQVSSLPNFDFNQRLKLNDCHFNIN 189 >UniRef50_UPI00006CBA23 Cluster: hypothetical protein TTHERM_00558420; n=1; Tetrahymena thermophila SB210|Rep: hypothetical protein TTHERM_00558420 - Tetrahymena thermophila SB210 Length = 651 Score = 32.3 bits (70), Expect = 7.3 Identities = 17/65 (26%), Positives = 31/65 (47%) Frame = -2 Query: 420 NDTVYNDSTFITTKLQDPGRIPSINKPLITITDKRTYRLK*LNRNHNSFHNITKYYFQTY 241 N+ N I K P + +I I D+ + L+++ + F+ + KYY++ Y Sbjct: 587 NNFYCNLGDIIIEKKNSPKKSNNIQYDNIKTIDEEETLINSLDKSQSQFNQLRKYYYKKY 646 Query: 240 SNRWI 226 SN +I Sbjct: 647 SNIYI 651 >UniRef50_Q8IBX7 Cluster: Putative uncharacterized protein MAL7P1.36; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein MAL7P1.36 - Plasmodium falciparum (isolate 3D7) Length = 119 Score = 32.3 bits (70), Expect = 7.3 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = -2 Query: 357 PSINKP-LITITDK-RTYRLK*LNRNHNSFHNITKYYFQTYSN 235 P+IN P +I + + Y K LN+ SFHN KY + SN Sbjct: 55 PNINYPSMIPVNNNYNNYNNKRLNKKKKSFHNFNKYTMEVNSN 97 >UniRef50_Q5AB73 Cluster: Putative uncharacterized protein; n=1; Candida albicans|Rep: Putative uncharacterized protein - Candida albicans (Yeast) Length = 245 Score = 31.9 bits (69), Expect = 9.6 Identities = 17/37 (45%), Positives = 22/37 (59%) Frame = -2 Query: 492 STTIL*LIESNSYLI*NTTIETGYNDTVYNDSTFITT 382 STT L ++ S Y + T T +N +V NDSTF TT Sbjct: 61 STTSLAMVSSTPYCLAAITGFTAFNRSVSNDSTFSTT 97 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 470,167,818 Number of Sequences: 1657284 Number of extensions: 8678032 Number of successful extensions: 18101 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 17553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18088 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 34156095254 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -