BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_K21 (538 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g57660.1 68416.m06424 DNA-directed RNA polymerase family prot... 31 0.64 At4g21326.1 68417.m03081 subtilase family protein contains simil... 27 6.0 >At3g57660.1 68416.m06424 DNA-directed RNA polymerase family protein similar to SP|O35134 DNA-directed RNA polymerase I largest subunit (EC 2.7.7.6) (RNA polymerase I 194 kDa subunit) (RPA194) {Mus musculus}; contains InterPro accession IPR000722: RNA polymerase, alpha subunit Length = 1670 Score = 30.7 bits (66), Expect = 0.64 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 2/34 (5%) Frame = -2 Query: 189 RLACPSCVGTILIYFPLYHFIL--I*FQYLFQSC 94 +LACP G I + FP+YH +L + F +L ++C Sbjct: 86 KLACPGHCGHIELVFPIYHPLLFNLLFNFLQRAC 119 >At4g21326.1 68417.m03081 subtilase family protein contains similarity to subtilase; SP1 GI:9957714 from [Oryza sativa] Length = 690 Score = 27.5 bits (58), Expect = 6.0 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -2 Query: 429 TGYNDTVYNDSTFITTKLQDP-GRIPSINKPLITITD 322 TGYNDT T TK P I +N P ITI D Sbjct: 562 TGYNDTSITIITGKPTKCSSPLPSILDLNYPAITIPD 598 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,917,911 Number of Sequences: 28952 Number of extensions: 180097 Number of successful extensions: 306 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 306 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 306 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 993966856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -