BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_K20 (461 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase ... 27 0.42 AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 26 0.74 AY748845-1|AAV28191.1| 102|Anopheles gambiae cytochrome P450 pr... 24 2.3 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 24 3.0 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 23 5.2 AY745226-1|AAU93493.1| 86|Anopheles gambiae cytochrome P450 pr... 22 9.1 >CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase protein. Length = 573 Score = 26.6 bits (56), Expect = 0.42 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 Query: 240 EPRALSL*FSFPVIGTLTIAPEVPSELTVSAP 145 EPRAL + +F + TLT+ P V S+ + P Sbjct: 6 EPRALGIVLAFLSVLTLTLLPPVSSQSDPTRP 37 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 25.8 bits (54), Expect = 0.74 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 32 LLVGVNSRYVLVEEPGYYIEQYEDQPEQW 118 +LVG+ + VL E GY+ E PE+W Sbjct: 411 ILVGMG-QLVLQREEGYFTRPSEFMPERW 438 >AY748845-1|AAV28191.1| 102|Anopheles gambiae cytochrome P450 protein. Length = 102 Score = 24.2 bits (50), Expect = 2.3 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +2 Query: 56 YVLVEEPGYYIEQYEDQPEQWANSRVRRQAGALTVNSDGT 175 Y+L P Y+ E + +PE++A+ +R A S G+ Sbjct: 14 YMLHHNPEYFPEPDQFRPERFADGETKRNPFAYIPFSAGS 53 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 23.8 bits (49), Expect = 3.0 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 Query: 130 GAPASGCTNCQLRRHLRCYGQG 195 G P S N R + RC+G+G Sbjct: 217 GGPGSALLNGSFRVYHRCFGRG 238 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 23.0 bits (47), Expect = 5.2 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +2 Query: 59 VLVEEPGYYIEQYEDQPEQWANSRVRRQAGALTVN 163 VL+ + Y+ E PE+W N R A VN Sbjct: 414 VLLRDEKYFHRPTEFIPERWLNDRDASIPSAKEVN 448 >AY745226-1|AAU93493.1| 86|Anopheles gambiae cytochrome P450 protein. Length = 86 Score = 22.2 bits (45), Expect = 9.1 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +2 Query: 71 EPGYYIEQYEDQPEQWANSRVRRQAGA 151 +P YY E ++ PE+++ +R GA Sbjct: 45 DPKYYPEPHQFDPERFSPARKVTHEGA 71 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 476,564 Number of Sequences: 2352 Number of extensions: 9465 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39969834 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -