BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_K18 (333 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0930 - 32801737-32801936,32802038-32802107 31 0.30 02_02_0072 + 6558642-6559115,6560055-6561107 30 0.39 02_01_0540 + 3948833-3948911,3948979-3949208 30 0.39 09_06_0243 - 21813223-21813456,21814266-21814367,21814501-218147... 30 0.52 06_03_0887 + 25688726-25689616,25689759-25690406 29 0.69 06_03_0891 + 25708864-25709596,25709629-25709729,25710047-257102... 29 0.91 07_03_1692 - 28733184-28733980,28734306-28734373,28734481-287345... 28 2.1 12_01_0746 + 6714525-6714612,6715832-6715917,6716450-6716557 27 2.8 03_06_0376 + 33479776-33479958,33481055-33481236,33481345-334814... 27 2.8 03_05_0196 + 21849370-21850278,21850424-21851050 27 2.8 02_05_0929 - 32798477-32798679,32798833-32798917 27 2.8 02_01_0528 + 3843535-3843601,3843809-3843984 27 2.8 07_01_0706 - 5325073-5326038 27 3.7 12_02_1276 - 27487424-27488050,27488258-27489172 27 4.9 02_01_0640 + 4796079-4797032,4797269-4797934 27 4.9 01_07_0036 + 40647046-40647100,40647120-40647571,40648135-406482... 27 4.9 04_01_0070 - 706640-706747,707221-707307,707397-707502,707585-70... 26 6.4 02_01_0646 + 4824243-4825139,4825220-4825852 26 6.4 12_01_0745 + 6710006-6710084,6710438-6710523,6711080-6711139 26 8.5 06_03_0885 + 25677243-25678157,25681064-25681705 26 8.5 06_03_0884 + 25651238-25652164,25653851-25654504 26 8.5 04_04_1304 + 32490971-32491552 26 8.5 02_01_0629 - 4721029-4721673,4721802-4722105,4722129-4722709 26 8.5 01_06_1638 + 38812226-38812660,38812989-38813063,38813180-388132... 26 8.5 01_03_0264 - 14419381-14419431,14419807-14419875,14420771-144208... 26 8.5 >02_05_0930 - 32801737-32801936,32802038-32802107 Length = 89 Score = 30.7 bits (66), Expect = 0.30 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +3 Query: 108 TIYVDPPFPRCVFYECIASCRQKGYKSG-GYCTINGCQC 221 T ++ +P C C+A+C Q+ Y+ G G C N C+C Sbjct: 34 TEVINREYPTCDSGLCVANC-QRQYRGGIGQCVGNKCKC 71 >02_02_0072 + 6558642-6559115,6560055-6561107 Length = 508 Score = 30.3 bits (65), Expect = 0.39 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 4/47 (8%) Frame = +3 Query: 54 AVHGEEENESSRT----LVKRDTIYVDPPFPRCVFYECIASCRQKGY 182 A GEE+ ++SR L ++T+ + PP P V E I +C KGY Sbjct: 345 ATVGEEDIQASRLTYLGLFIKETLRLHPPVPLLVPRESIDTCEIKGY 391 >02_01_0540 + 3948833-3948911,3948979-3949208 Length = 102 Score = 30.3 bits (65), Expect = 0.39 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 2/27 (7%) Frame = +3 Query: 153 CIASCRQKGYKSGGYCTI--NGCQCLR 227 CIA C +GY +GGYCT + C C + Sbjct: 52 CIACCTNEGY-TGGYCTTVRHKCMCTK 77 >09_06_0243 - 21813223-21813456,21814266-21814367,21814501-21814701, 21815591-21815716,21815791-21816072,21816218-21816388, 21816838-21816999,21817404-21817467,21818136-21818503 Length = 569 Score = 29.9 bits (64), Expect = 0.52 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 150 ECIASCRQKGYKSGGYCTINGCQCLR*LHSSFE 248 +C SC+Q K+G +N C++ LH FE Sbjct: 395 DCEESCQQHQSKAGDPLPVNTTNCIQKLHDEFE 427 >06_03_0887 + 25688726-25689616,25689759-25690406 Length = 512 Score = 29.5 bits (63), Expect = 0.69 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 93 LVKRDTIYVDPPFPRCVFYECIASCRQKGY 182 LV R+T+ + PP P + EC CR GY Sbjct: 357 LVVRETLRLHPPLPLLLPRECREPCRVLGY 386 >06_03_0891 + 25708864-25709596,25709629-25709729,25710047-25710259, 25710328-25710969 Length = 562 Score = 29.1 bits (62), Expect = 0.91 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 93 LVKRDTIYVDPPFPRCVFYECIASCRQKGY 182 LV R+T+ + PP P + EC CR GY Sbjct: 407 LVIRETLRLHPPLPLLLPRECREPCRVLGY 436 >07_03_1692 - 28733184-28733980,28734306-28734373,28734481-28734594, 28734835-28734884,28735012-28735422,28735534-28735610, 28736083-28736257,28736843-28736939,28737070-28737833, 28737900-28738001,28738093-28738174,28739004-28739161 Length = 964 Score = 27.9 bits (59), Expect = 2.1 Identities = 19/59 (32%), Positives = 25/59 (42%) Frame = +3 Query: 51 AAVHGEEENESSRTLVKRDTIYVDPPFPRCVFYECIASCRQKGYKSGGYCTINGCQCLR 227 AAV+G+ N+ S ++ T P C CI KG K CT N C +R Sbjct: 728 AAVYGDVGNQGSPSVAT--TTKHPRHRPGCTCIVCIQPPSGKGPKHNPACTCNVCMTVR 784 >12_01_0746 + 6714525-6714612,6715832-6715917,6716450-6716557 Length = 93 Score = 27.5 bits (58), Expect = 2.8 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = +3 Query: 132 PRCVFYECIASCRQKGYK 185 P+C +EC+A C ++G++ Sbjct: 41 PKCTEHECMADCHRRGFQ 58 >03_06_0376 + 33479776-33479958,33481055-33481236,33481345-33481469, 33481858-33482057,33482629-33482762,33483095-33483158, 33483764-33484441,33484723-33484839 Length = 560 Score = 27.5 bits (58), Expect = 2.8 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 21 VFAIFLMTVFAAVHGEEENESSRTLVKRDTIYVDPPFPRC 140 V A+ L+ AA G EE E+ T +R +VD RC Sbjct: 10 VAAVLLVAGAAAAGGGEEEEAPSTCARRGPGFVDALASRC 49 >03_05_0196 + 21849370-21850278,21850424-21851050 Length = 511 Score = 27.5 bits (58), Expect = 2.8 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +3 Query: 93 LVKRDTIYVDPPFPRCVFYECIASCRQKGY 182 LV ++T+ + PP P + EC +C+ GY Sbjct: 361 LVIKETLRLHPPAPLLIPRECRETCQVMGY 390 >02_05_0929 - 32798477-32798679,32798833-32798917 Length = 95 Score = 27.5 bits (58), Expect = 2.8 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +3 Query: 117 VDPPFPRCVFYECIASCRQKGYKSG-GYCTINGCQCL 224 ++P P C EC +C ++ YK G G C C+C+ Sbjct: 49 LNPGAPSCDSGECATNCPRQ-YKGGVGQCIGTQCKCV 84 >02_01_0528 + 3843535-3843601,3843809-3843984 Length = 80 Score = 27.5 bits (58), Expect = 2.8 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +3 Query: 96 VKRDTIYVDPPFPRCVFYECIASCR-QKGYKSGGYCTINGCQC 221 V D V+ P P C C +C+ Q G + G CT GCQC Sbjct: 28 VSADCQSVNVPGP-CSPTTCDDNCKSQIGAGAVGECTSGGCQC 69 >07_01_0706 - 5325073-5326038 Length = 321 Score = 27.1 bits (57), Expect = 3.7 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -2 Query: 206 DGAVPTAFVSLLSAASNALVKHTSREWRIYVYRVPFD 96 D A+ A + +LS A V H REW V + +D Sbjct: 44 DVAIMNALLRMLSEADEGTVVHFVREWMKQVRELAYD 80 >12_02_1276 - 27487424-27488050,27488258-27489172 Length = 513 Score = 26.6 bits (56), Expect = 4.9 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 93 LVKRDTIYVDPPFPRCVFYECIASCRQKGY 182 LV ++T+ + PP P V E I +C GY Sbjct: 365 LVMKETLRLHPPAPLLVPRESIDACEINGY 394 >02_01_0640 + 4796079-4797032,4797269-4797934 Length = 539 Score = 26.6 bits (56), Expect = 4.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 93 LVKRDTIYVDPPFPRCVFYECIASCRQKGY 182 L+ ++T+ + P P V EC SC+ GY Sbjct: 376 LIIKETLRLHPVVPLLVARECRESCKVMGY 405 >01_07_0036 + 40647046-40647100,40647120-40647571,40648135-40648257, 40648407-40648461,40648613-40648722,40649352-40649531, 40650003-40650101,40651182-40651280,40652195-40652289, 40652290-40652378,40652739-40652901,40653299-40653404, 40655647-40655829,40656059-40656286,40656373-40656486 Length = 716 Score = 26.6 bits (56), Expect = 4.9 Identities = 20/73 (27%), Positives = 29/73 (39%), Gaps = 1/73 (1%) Frame = +3 Query: 6 MKACLVFAIFLMTVFAA-VHGEEENESSRTLVKRDTIYVDPPFPRCVFYECIASCRQKGY 182 + C+ A+ L + + G +EN + + DPP P F + KG Sbjct: 411 ISCCMTCALLLSRLVCDDISGGQENLP----IPATNLVDDPPVPPTGFVYSKSLKIPKGI 466 Query: 183 KSGGYCTINGCQC 221 K YC NGC C Sbjct: 467 KIPSYC--NGCDC 477 >04_01_0070 - 706640-706747,707221-707307,707397-707502,707585-707693, 707766-708145,708508-708601,709351-709475,709633-709674, 710822-710892,710979-711060,711157-711277,712404-712713 Length = 544 Score = 26.2 bits (55), Expect = 6.4 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = -3 Query: 145 NTHLGNGGSTYIVSLLTKVREDSFSSSPCTAAKTVIRKIANT 20 +T+LG+ S+ + + + D + PC A + VI K+ NT Sbjct: 257 STYLGSAASSIDIIRMYNLSSDMTTRGPCEAFE-VITKVGNT 297 >02_01_0646 + 4824243-4825139,4825220-4825852 Length = 509 Score = 26.2 bits (55), Expect = 6.4 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +3 Query: 93 LVKRDTIYVDPPFPRCVFYECIASCRQKGY 182 LV ++T+ + PP P + EC +C+ GY Sbjct: 359 LVIKETLRLHPPAPLLLPRECGGACKVFGY 388 >12_01_0745 + 6710006-6710084,6710438-6710523,6711080-6711139 Length = 74 Score = 25.8 bits (54), Expect = 8.5 Identities = 6/18 (33%), Positives = 13/18 (72%) Frame = +3 Query: 132 PRCVFYECIASCRQKGYK 185 P+C + C+A C ++G++ Sbjct: 38 PKCTEHACVADCNRRGFQ 55 >06_03_0885 + 25677243-25678157,25681064-25681705 Length = 518 Score = 25.8 bits (54), Expect = 8.5 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 93 LVKRDTIYVDPPFPRCVFYECIASCRQKGY 182 LV ++T+ + PP P + EC C+ GY Sbjct: 363 LVIKETLRLHPPGPLLLPRECREQCKVLGY 392 >06_03_0884 + 25651238-25652164,25653851-25654504 Length = 526 Score = 25.8 bits (54), Expect = 8.5 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 93 LVKRDTIYVDPPFPRCVFYECIASCRQKGY 182 LV R+T + PP P + EC C+ GY Sbjct: 369 LVIRETFRLHPPGPLLLPRECSEPCQVLGY 398 >04_04_1304 + 32490971-32491552 Length = 193 Score = 25.8 bits (54), Expect = 8.5 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -2 Query: 188 AFVSLLSAASNALVKHTSREWRIYVYRVPFDQSARRF 78 +F+SL S + K T E +Y + PFD + RRF Sbjct: 93 SFLSLRDEHSPGVAKKTIAE--LYGHATPFDAAGRRF 127 >02_01_0629 - 4721029-4721673,4721802-4722105,4722129-4722709 Length = 509 Score = 25.8 bits (54), Expect = 8.5 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 93 LVKRDTIYVDPPFPRCVFYECIASCRQKGY 182 LV ++T+ + P P V EC SC+ GY Sbjct: 353 LVIKETLRLHPAAPMLVPRECGESCKVLGY 382 >01_06_1638 + 38812226-38812660,38812989-38813063,38813180-38813284, 38813387-38813472,38813554-38813674,38813761-38813840, 38814005-38814067,38814205-38814326,38814429-38814514, 38814626-38814750,38814883-38814911,38815188-38815333, 38815643-38815822,38816445-38816585 Length = 597 Score = 25.8 bits (54), Expect = 8.5 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -3 Query: 304 YVYILERKCYTKK*VYIKISNEL*SYRRHWHPLMVQY 194 +V IL+R+CY + V +EL + HP +VQ+ Sbjct: 219 HVKILDRECYCDQEVINSFRHELTVLEKVRHPNVVQF 255 >01_03_0264 - 14419381-14419431,14419807-14419875,14420771-14420817, 14421340-14422474 Length = 433 Score = 25.8 bits (54), Expect = 8.5 Identities = 14/47 (29%), Positives = 20/47 (42%) Frame = +1 Query: 88 ALWSKGTRYT*ILHSRDVCFTSALLAADKRDTKAVGTAPSMDANVCD 228 AL+S +T DVC + +L A D + S+D N D Sbjct: 79 ALYSDPGNFTGDWAGPDVCAYNGVLCAPSPDNASASAVASLDMNAAD 125 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,045,922 Number of Sequences: 37544 Number of extensions: 184801 Number of successful extensions: 434 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 432 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 434 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 459426840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -