SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0001_K17
         (552 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ223627-1|CAA11500.1|  371|Tribolium castaneum orthodenticle-1 ...    23   1.8  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    21   7.2  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    21   7.2  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    21   7.2  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    21   7.2  
AY600513-1|AAT11861.1|  314|Tribolium castaneum spalt-like prote...    21   9.5  

>AJ223627-1|CAA11500.1|  371|Tribolium castaneum orthodenticle-1
           protein protein.
          Length = 371

 Score = 23.0 bits (47), Expect = 1.8
 Identities = 10/26 (38%), Positives = 14/26 (53%)
 Frame = -1

Query: 528 LPTPSACPVPXLESLTRGVPQRISYR 451
           +PTPS    P   ++ +  PQ  SYR
Sbjct: 224 IPTPSTSASPPTVNIKKESPQMQSYR 249


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
            variant 2 protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 7.2
 Identities = 8/14 (57%), Positives = 12/14 (85%)
 Frame = +1

Query: 340  SGSYPMKLGRRRSI 381
            SGS P ++GRR++I
Sbjct: 1405 SGSGPDRIGRRKTI 1418


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
            variant 1 protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 7.2
 Identities = 8/14 (57%), Positives = 12/14 (85%)
 Frame = +1

Query: 340  SGSYPMKLGRRRSI 381
            SGS P ++GRR++I
Sbjct: 1405 SGSGPDRIGRRKTI 1418


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B
            protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 7.2
 Identities = 8/14 (57%), Positives = 12/14 (85%)
 Frame = +1

Query: 340  SGSYPMKLGRRRSI 381
            SGS P ++GRR++I
Sbjct: 1405 SGSGPDRIGRRKTI 1418


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A
            protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 7.2
 Identities = 8/14 (57%), Positives = 12/14 (85%)
 Frame = +1

Query: 340  SGSYPMKLGRRRSI 381
            SGS P ++GRR++I
Sbjct: 1405 SGSGPDRIGRRKTI 1418


>AY600513-1|AAT11861.1|  314|Tribolium castaneum spalt-like protein
           protein.
          Length = 314

 Score = 20.6 bits (41), Expect = 9.5
 Identities = 12/34 (35%), Positives = 15/34 (44%)
 Frame = +3

Query: 30  PSIHNRLGTMKKITFAVACLLALSSVYAGDRCYE 131
           PSIHN +       FAV  L  L    + +  YE
Sbjct: 244 PSIHNSINPFLGQGFAVPGLSPLGHTLSMNHKYE 277


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 121,800
Number of Sequences: 336
Number of extensions: 2444
Number of successful extensions: 6
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 13621010
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -