BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_K17 (552 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 23 1.8 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 7.2 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 7.2 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 7.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 7.2 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 21 9.5 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 23.0 bits (47), Expect = 1.8 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -1 Query: 528 LPTPSACPVPXLESLTRGVPQRISYR 451 +PTPS P ++ + PQ SYR Sbjct: 224 IPTPSTSASPPTVNIKKESPQMQSYR 249 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +1 Query: 340 SGSYPMKLGRRRSI 381 SGS P ++GRR++I Sbjct: 1405 SGSGPDRIGRRKTI 1418 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +1 Query: 340 SGSYPMKLGRRRSI 381 SGS P ++GRR++I Sbjct: 1405 SGSGPDRIGRRKTI 1418 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +1 Query: 340 SGSYPMKLGRRRSI 381 SGS P ++GRR++I Sbjct: 1405 SGSGPDRIGRRKTI 1418 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +1 Query: 340 SGSYPMKLGRRRSI 381 SGS P ++GRR++I Sbjct: 1405 SGSGPDRIGRRKTI 1418 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 20.6 bits (41), Expect = 9.5 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +3 Query: 30 PSIHNRLGTMKKITFAVACLLALSSVYAGDRCYE 131 PSIHN + FAV L L + + YE Sbjct: 244 PSIHNSINPFLGQGFAVPGLSPLGHTLSMNHKYE 277 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,800 Number of Sequences: 336 Number of extensions: 2444 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13621010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -