BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_K15 (482 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 1.7 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 1.7 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 22 4.0 M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-... 21 9.1 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 21 9.1 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.0 bits (47), Expect = 1.7 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -1 Query: 104 SAVATNSATMGRHHSHVQAPPPPP 33 S++ ++ +T+ R Q PPPPP Sbjct: 1336 SSIDSDYSTLERTAWRQQQPPPPP 1359 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 23.0 bits (47), Expect = 1.7 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 Query: 80 TMGRHHSHVQAPP 42 TMG HSH+ A P Sbjct: 418 TMGHGHSHIHATP 430 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 21.8 bits (44), Expect = 4.0 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 Query: 135 QNGRHPESHQQRRSH 91 QN H SHQ R+H Sbjct: 118 QNNNHYTSHQHLRTH 132 >M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E60. ). Length = 109 Score = 20.6 bits (41), Expect = 9.1 Identities = 13/48 (27%), Positives = 20/48 (41%) Frame = -3 Query: 393 RTPGEGGGRYRSQQRPEPKQCACRLRHYVPERCEDRQPAQRDCRQCHR 250 R+ G G G ++RP +L E E+R +R +Q R Sbjct: 8 RSDGRGNGGTPEEKRPRTAFSGEQLARLKREFAENRYLTERRRQQLSR 55 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 20.6 bits (41), Expect = 9.1 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 50 APPPPPATLS 21 APPPPP + S Sbjct: 342 APPPPPPSSS 351 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,332 Number of Sequences: 438 Number of extensions: 1988 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13174803 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -