BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_K14 (633 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g43990.2 68418.m05382 SET domain-containing protein identical... 33 0.21 At5g43990.1 68418.m05383 SET domain-containing protein identical... 33 0.21 At5g40480.1 68418.m04909 expressed protein ; expression supporte... 30 1.1 At5g28623.1 68418.m03496 hypothetical protein 28 4.5 At1g12120.1 68414.m01404 expressed protein contains Pfam domain ... 27 7.8 >At5g43990.2 68418.m05382 SET domain-containing protein identical to SET domain protein SUVR2 [Arabidopsis thaliana] GI:15290521; contains Pfam profiles PF00856: SET domain, PF05033: Pre-SET motif; identical to cDNA SET domain protein SUVR2 GI:15290520 Length = 740 Score = 32.7 bits (71), Expect = 0.21 Identities = 20/78 (25%), Positives = 42/78 (53%), Gaps = 1/78 (1%) Frame = +1 Query: 127 TSSRVRRQAGELTINSDGTSGAMVKVPITGNENHKLSALGSVDLTNQIKLGAATAGLVYD 306 ++ V +AGE +DGT+ + + +HKL+A +++ ++L ++ +G V Sbjct: 219 SNGHVEEKAGETVSTADGTTNDISPTTVARFSDHKLAA--TIEEPPALELASSASGEVKI 276 Query: 307 NVNRHGAT-LTNTHIPGI 357 N++ AT +N H+P + Sbjct: 277 NLSFAPATGGSNPHLPSM 294 >At5g43990.1 68418.m05383 SET domain-containing protein identical to SET domain protein SUVR2 [Arabidopsis thaliana] GI:15290521; contains Pfam profiles PF00856: SET domain, PF05033: Pre-SET motif; identical to cDNA SET domain protein SUVR2 GI:15290520 Length = 717 Score = 32.7 bits (71), Expect = 0.21 Identities = 20/78 (25%), Positives = 42/78 (53%), Gaps = 1/78 (1%) Frame = +1 Query: 127 TSSRVRRQAGELTINSDGTSGAMVKVPITGNENHKLSALGSVDLTNQIKLGAATAGLVYD 306 ++ V +AGE +DGT+ + + +HKL+A +++ ++L ++ +G V Sbjct: 196 SNGHVEEKAGETVSTADGTTNDISPTTVARFSDHKLAA--TIEEPPALELASSASGEVKI 253 Query: 307 NVNRHGAT-LTNTHIPGI 357 N++ AT +N H+P + Sbjct: 254 NLSFAPATGGSNPHLPSM 271 >At5g40480.1 68418.m04909 expressed protein ; expression supported by MPSS Length = 1919 Score = 30.3 bits (65), Expect = 1.1 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +1 Query: 265 QIKLGAATAGLVYDNVNRHGATLTNTHIPGIGDKLSVAGKVNLFHNNDH 411 Q K+ +Y V+ G TLTN H+P G K V + N F +H Sbjct: 1597 QTKVTVLFGNTIY--VDSPGETLTNVHVPAEGYKFPVKFRENKFAVTEH 1643 >At5g28623.1 68418.m03496 hypothetical protein Length = 236 Score = 28.3 bits (60), Expect = 4.5 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = +1 Query: 496 EYMFKDKIGASASAXHTDFFNKNDYYLGGKLNLFKTPSTSL 618 E+ K +GA S H F +Y+ + FK P T L Sbjct: 67 EFFTKMGLGAFTSMDHATFSEPTNYFFSTMVYTFKNPKTPL 107 >At1g12120.1 68414.m01404 expressed protein contains Pfam domain PF05904: Plant protein of unknown function (DUF863) Length = 483 Score = 27.5 bits (58), Expect = 7.8 Identities = 20/81 (24%), Positives = 36/81 (44%), Gaps = 4/81 (4%) Frame = +1 Query: 253 DLTNQIKLGAATAGLVYDNVNRH--GATLTNTHIPGIGDKLSVAGKVNLFHNNDHDLSAK 426 D ++ ++G A G YD+ RH G + TNT +++ N+ +N+ ++ K Sbjct: 347 DFPDKPEMGKAKPGCSYDSYERHTLGISETNTEEDFCVSSMALDELNNITRDNNKEIGLK 406 Query: 427 AFATRNMPTISH--LPSTNTV 483 R M LPS ++ Sbjct: 407 LRRGRRMKNFQKEILPSLTSL 427 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,634,392 Number of Sequences: 28952 Number of extensions: 284271 Number of successful extensions: 680 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 668 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 680 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1295224128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -