BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_K11 (574 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 23 2.4 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 21 5.6 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 21 9.9 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 21 9.9 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 22.6 bits (46), Expect = 2.4 Identities = 12/49 (24%), Positives = 22/49 (44%) Frame = +1 Query: 145 KTQVMGASFRNTGEIRELAGCDLLTISPKLLQELAGSDHPLKRVLDPKL 291 KT ++ A ++ +L D+L ++ K LQ L + DP + Sbjct: 58 KTLILDAMKKDPARHSKLEKADILEMTVKHLQNLQRQQAAMSAATDPSV 106 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 21.4 bits (43), Expect = 5.6 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = -3 Query: 440 VLIRDSSFLVSAANFRIPSDNLSVAI*SSFICQRNCDSDNDIF 312 ++I S F+ + + +RI + ++ SFI N + IF Sbjct: 236 IIISGSIFMTTTSFYRILNSGYNLTTFGSFIFNANSAIEGIIF 278 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 20.6 bits (41), Expect = 9.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -1 Query: 565 TIISQFIVKIPKTTYKTCYILNIICYK 485 +I+ QF+ + T K +L CYK Sbjct: 144 SILQQFVAIFNEETDKLVEVLKEECYK 170 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 20.6 bits (41), Expect = 9.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -1 Query: 565 TIISQFIVKIPKTTYKTCYILNIICYK 485 +I+ QF+ + T K +L CYK Sbjct: 144 SILQQFVAIFNEETDKLVEVLKEECYK 170 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,215 Number of Sequences: 336 Number of extensions: 2847 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14203976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -