BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_K10 (499 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.53 SB_7677| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_22964| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_33543| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_30460| Best HMM Match : DSPc (HMM E-Value=2.5e-38) 28 4.9 SB_58205| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.5 SB_47642| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) 27 6.5 SB_15021| Best HMM Match : Zona_pellucida (HMM E-Value=0) 27 6.5 SB_34654| Best HMM Match : zf-C2H2 (HMM E-Value=8e-31) 27 8.6 SB_24692| Best HMM Match : Disintegrin (HMM E-Value=7.6e-23) 27 8.6 SB_58553| Best HMM Match : rve (HMM E-Value=0.0011) 27 8.6 SB_10552| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 >SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1778 Score = 31.1 bits (67), Expect = 0.53 Identities = 26/97 (26%), Positives = 41/97 (42%), Gaps = 2/97 (2%) Frame = +2 Query: 116 EDQPEQWANSRVRRQAGALTVNSDGTSGAMVKVPITGNENHRLSALGSVDLTNQMKLGAA 295 +++P V+ + T+N + +K + GN + L A S N K G Sbjct: 651 DNEPVTETIDSVKEEDSKATINCIRNNNTYIKQSVEGNNSFSLDASSS---ENVRKEGDK 707 Query: 296 TAGLAY-DNVNGHGATLT-KTHIPGFGDKMTAAGKVN 400 ++Y DN+N A T + IPG K + KVN Sbjct: 708 DVVISYSDNMNNSKAANTDQFGIPGSDSKTGSDSKVN 744 >SB_7677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 28.7 bits (61), Expect = 2.8 Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 1/69 (1%) Frame = +3 Query: 57 SASTAGTCSLKSLVTTLNNMRISRSSGPTPGCAGKRVH*LSTQTAPQVLWSRYL*LETKI 236 SA+TA S+ + TL +S ++GPTP + ++ L+ + + L + + + Sbjct: 113 SATTAQDSSVLDTLATLATATLSHNTGPTPSTSMQQATSLAGRISVTPLTLSQNTISSSL 172 Query: 237 TG-SVPLAP 260 +G S PL P Sbjct: 173 SGLSTPLTP 181 >SB_22964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1506 Score = 27.9 bits (59), Expect = 4.9 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +2 Query: 365 FGDKMTAAGKVNLFH---NDNHDFSAKAFATKNLPNIPQVPNFNTV 493 FGDK A + FH ND D S + T+ + ++ +P + TV Sbjct: 587 FGDKWIGANTIRAFHHTDNDGIDASENSNLTRIIFDLSTLPMYETV 632 >SB_33543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 838 Score = 27.9 bits (59), Expect = 4.9 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 75 TCSLKSLVTTLNNMRISRSSGPTPGC 152 T + K+++TTL MRI ++GP C Sbjct: 654 TTTKKTIITTLTTMRICAANGPLIDC 679 >SB_30460| Best HMM Match : DSPc (HMM E-Value=2.5e-38) Length = 550 Score = 27.9 bits (59), Expect = 4.9 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 2/90 (2%) Frame = +2 Query: 197 GAMVKVPITGNENHRLSALGSVDLTNQMKLGAATAGLAYDNVNGHGATLTKTHIPGFGDK 376 G V +T E +L ALG +T+ + T L++ N + A+ K+ I G Sbjct: 401 GIYVGGAVTAMEEDQLVALG---VTHVLNAAQGTKRLSHVNTD---ASFYKSGIIFHGIP 454 Query: 377 MTAAG--KVNLFHNDNHDFSAKAFATKNLP 460 T K+N + ++ DF A A TKN P Sbjct: 455 ATDVFMFKLNKYFDEAADFIASAVGTKNCP 484 >SB_58205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.5 bits (58), Expect = 6.5 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 148 GAPASGCTNCQLRRHLRCYGQGTYNWKRKS 237 G PA N QL R RC TY W RKS Sbjct: 73 GKPAYFAKNLQLDRK-RCLYPKTYTWDRKS 101 >SB_47642| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) Length = 1336 Score = 27.5 bits (58), Expect = 6.5 Identities = 22/87 (25%), Positives = 37/87 (42%) Frame = +2 Query: 68 SRYVLVEEPGYYIEQYEDQPEQWANSRVRRQAGALTVNSDGTSGAMVKVPITGNENHRLS 247 +R + EP ++ EDQ E A+S +R +AG +D G + + T N NH Sbjct: 1183 ARKAQINEPPSPLKVQEDQRETEAHSPIRTRAGREATCNDHLKGCVNQA--TCN-NHLKG 1239 Query: 248 ALGSVDLTNQMKLGAATAGLAYDNVNG 328 + + +K G D++ G Sbjct: 1240 CVNQATCNDHLK-GCVNQATCNDHLKG 1265 >SB_15021| Best HMM Match : Zona_pellucida (HMM E-Value=0) Length = 751 Score = 27.5 bits (58), Expect = 6.5 Identities = 19/57 (33%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = +2 Query: 332 GATLTKTHIPGFGDKMTAAGKVNLFHNDNHDFSAKAFATKNLPNIPQ-VPNFNTVGA 499 G+T T IPG G + GK ++ N H S A P VP T GA Sbjct: 322 GSTTKTTKIPGPGKIHISTGKPSITDNTKHKTSPSADGKGGKGEEPTIVPEMTTQGA 378 >SB_34654| Best HMM Match : zf-C2H2 (HMM E-Value=8e-31) Length = 624 Score = 27.1 bits (57), Expect = 8.6 Identities = 23/96 (23%), Positives = 39/96 (40%), Gaps = 2/96 (2%) Frame = +2 Query: 86 EEPGYYIEQYE--DQPEQWANSRVRRQAGALTVNSDGTSGAMVKVPITGNENHRLSALGS 259 E Y E+YE D AN QA + N+ ++G ++ + ++G + ++ A S Sbjct: 113 ERSEYGGERYETSDFQRSVANRYKELQADSWKKNNVTSAGGLLSLDLSGEGHFKVHANAS 172 Query: 260 VDLTNQMKLGAATAGLAYDNVNGHGATLTKTHIPGF 367 + + Y + A L HIPGF Sbjct: 173 TAIPAAETTDWPQENI-YSTIQYQEAPLPPAHIPGF 207 >SB_24692| Best HMM Match : Disintegrin (HMM E-Value=7.6e-23) Length = 1592 Score = 27.1 bits (57), Expect = 8.6 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +1 Query: 169 TNCQLRRHL-RCYGQGTYNWKRKSQAQCPWLRRS 267 TN Q L R Y YNW+ + + PWL ++ Sbjct: 1207 TNIQTNVSLVRKYNSWEYNWRNSLEKRMPWLGKT 1240 >SB_58553| Best HMM Match : rve (HMM E-Value=0.0011) Length = 1745 Score = 27.1 bits (57), Expect = 8.6 Identities = 16/60 (26%), Positives = 29/60 (48%) Frame = +3 Query: 39 SYQFFWSASTAGTCSLKSLVTTLNNMRISRSSGPTPGCAGKRVH*LSTQTAPQVLWSRYL 218 S+ FW +S+ + S S+ +L+++R S G + LS T P W+R++ Sbjct: 376 SHSGFWFSSSRFSRSSSSISDSLSSLRSRASWRRLTDVLGSSMVSLSVATTPCSSWARFV 435 >SB_10552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 27.1 bits (57), Expect = 8.6 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 2/59 (3%) Frame = +2 Query: 269 TNQMKLGAATAGLAYDNVNGHGAT--LTKTHIPGFGDKMTAAGKVNLFHNDNHDFSAKA 439 TNQ L Y+ +N A L + +P G+K +G+ N+ D DFS A Sbjct: 59 TNQTLLHVVVLDTQYERMNSTYACALLANSRLPCVGEKDCESGEGNISSIDMKDFSNAA 117 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,495,431 Number of Sequences: 59808 Number of extensions: 341634 Number of successful extensions: 873 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 823 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 873 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -